Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2ACU8

Protein Details
Accession A0A1Y2ACU8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-40NAEQRKKNLQELRNRRKNKLNKRQINESEKLHydrophilic
NLS Segment(s)
PositionSequence
22-28RNRRKNK
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013169  mRNA_splic_Cwf18-like  
Pfam View protein in Pfam  
PF08315  cwf18  
Amino Acid Sequences MEANLNTLNNAEQRKKNLQELRNRRKNKLNKRQINESEKLDDNDEIINEITVESVVEKYVKETLNKEKEKTSEINLQDLAPKKPNWDFKRDLEKKLEKLEKKTQICINEIIIIRERLKESGDIFSVPTSIEEMC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.51
3 0.58
4 0.62
5 0.64
6 0.68
7 0.75
8 0.79
9 0.8
10 0.81
11 0.78
12 0.79
13 0.82
14 0.83
15 0.83
16 0.83
17 0.82
18 0.83
19 0.88
20 0.87
21 0.84
22 0.77
23 0.69
24 0.63
25 0.55
26 0.49
27 0.41
28 0.31
29 0.24
30 0.2
31 0.16
32 0.12
33 0.1
34 0.08
35 0.06
36 0.06
37 0.05
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.06
46 0.1
47 0.12
48 0.13
49 0.16
50 0.26
51 0.35
52 0.37
53 0.37
54 0.36
55 0.36
56 0.38
57 0.36
58 0.31
59 0.29
60 0.28
61 0.29
62 0.26
63 0.25
64 0.25
65 0.26
66 0.25
67 0.21
68 0.2
69 0.21
70 0.27
71 0.37
72 0.36
73 0.41
74 0.43
75 0.47
76 0.58
77 0.59
78 0.58
79 0.57
80 0.6
81 0.57
82 0.62
83 0.64
84 0.57
85 0.6
86 0.65
87 0.66
88 0.62
89 0.65
90 0.6
91 0.55
92 0.53
93 0.47
94 0.39
95 0.35
96 0.33
97 0.29
98 0.27
99 0.27
100 0.25
101 0.26
102 0.26
103 0.21
104 0.23
105 0.23
106 0.22
107 0.24
108 0.24
109 0.21
110 0.21
111 0.2
112 0.19
113 0.16
114 0.14