Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1Z7D9

Protein Details
Accession A0A1Y1Z7D9    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
35-64NIEIAKKDSIKKKEKNKKNKKVNQIENGISHydrophilic
NLS Segment(s)
PositionSequence
40-55KKDSIKKKEKNKKNKK
Subcellular Location(s) nucl 12.5, cyto_nucl 9, mito 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MIDLKFVNREFSTNLLLHRLLTQSYQNSTTNDSDNIEIAKKDSIKKKEKNKKNKKVNQIENGISQITSFNYILNGIPESTELSFVNIPYFKNLLKKNHMVKWNGVASYTPSLKDVLFYFNSPSFIYISYTPFFFKFSKKDLNINLSNTRTGIFLDYPNKVEKLNEPGISQLVNSDEFMLFLSLQGINNICYQPFCSTLSNNELIFKSLLDNAKPVDVVLYNFYIKDKLPRLTFRIYGIPNTINTKNNII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.26
4 0.24
5 0.24
6 0.23
7 0.19
8 0.19
9 0.24
10 0.23
11 0.27
12 0.3
13 0.3
14 0.3
15 0.33
16 0.34
17 0.31
18 0.28
19 0.27
20 0.24
21 0.22
22 0.22
23 0.19
24 0.17
25 0.16
26 0.18
27 0.2
28 0.27
29 0.34
30 0.42
31 0.51
32 0.59
33 0.69
34 0.76
35 0.83
36 0.87
37 0.9
38 0.91
39 0.92
40 0.93
41 0.93
42 0.93
43 0.92
44 0.89
45 0.84
46 0.76
47 0.67
48 0.59
49 0.48
50 0.37
51 0.27
52 0.19
53 0.13
54 0.13
55 0.11
56 0.09
57 0.09
58 0.1
59 0.1
60 0.11
61 0.11
62 0.07
63 0.07
64 0.08
65 0.09
66 0.08
67 0.1
68 0.09
69 0.1
70 0.11
71 0.1
72 0.13
73 0.12
74 0.12
75 0.13
76 0.15
77 0.14
78 0.2
79 0.26
80 0.3
81 0.34
82 0.42
83 0.46
84 0.51
85 0.55
86 0.51
87 0.47
88 0.47
89 0.44
90 0.36
91 0.3
92 0.24
93 0.2
94 0.22
95 0.21
96 0.15
97 0.12
98 0.13
99 0.13
100 0.13
101 0.12
102 0.11
103 0.12
104 0.12
105 0.13
106 0.13
107 0.15
108 0.14
109 0.14
110 0.11
111 0.1
112 0.11
113 0.1
114 0.12
115 0.11
116 0.12
117 0.12
118 0.11
119 0.14
120 0.14
121 0.16
122 0.17
123 0.21
124 0.29
125 0.3
126 0.35
127 0.36
128 0.42
129 0.42
130 0.43
131 0.42
132 0.35
133 0.34
134 0.29
135 0.25
136 0.18
137 0.15
138 0.13
139 0.1
140 0.12
141 0.16
142 0.17
143 0.18
144 0.2
145 0.2
146 0.18
147 0.18
148 0.17
149 0.21
150 0.25
151 0.24
152 0.23
153 0.23
154 0.24
155 0.23
156 0.2
157 0.13
158 0.1
159 0.09
160 0.09
161 0.09
162 0.09
163 0.09
164 0.09
165 0.09
166 0.07
167 0.06
168 0.08
169 0.07
170 0.07
171 0.08
172 0.09
173 0.09
174 0.12
175 0.12
176 0.11
177 0.1
178 0.12
179 0.13
180 0.15
181 0.17
182 0.17
183 0.18
184 0.22
185 0.27
186 0.28
187 0.27
188 0.28
189 0.25
190 0.25
191 0.23
192 0.19
193 0.16
194 0.18
195 0.2
196 0.18
197 0.19
198 0.18
199 0.19
200 0.19
201 0.17
202 0.14
203 0.13
204 0.13
205 0.14
206 0.16
207 0.15
208 0.16
209 0.17
210 0.16
211 0.16
212 0.23
213 0.26
214 0.3
215 0.36
216 0.42
217 0.47
218 0.51
219 0.53
220 0.48
221 0.51
222 0.46
223 0.43
224 0.42
225 0.39
226 0.36
227 0.4
228 0.41
229 0.36