Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2AFW2

Protein Details
Accession A0A1Y2AFW2    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
47-71AMFYLYKKWQQRKYAKEFKKNNMIRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR000403  PI3/4_kinase_cat_dom  
IPR036940  PI3/4_kinase_cat_sf  
IPR018936  PI3/4_kinase_CS  
Gene Ontology GO:0016301  F:kinase activity  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF00454  PI3_PI4_kinase  
PROSITE View protein in PROSITE  
PS00916  PI3_4_KINASE_2  
PS50290  PI3_4_KINASE_3  
Amino Acid Sequences MQLLSCTNHILKINKKSNIRNLQARNYSVVPLSSHLGMIQWVTNATAMFYLYKKWQQRKYAKEFKKNNMIRGPIRKNWPINIQRNAFLELRHETPKDLIAKEFWTSSSSPTVWWEKTNSYSRSLAVMSIIGYIIGLGDRHLDNILIDFDTGEVIHIDYNVCFEKGKKLCVPETVPFRLTQNLQNALGVYGIEGPFRIACENVLSVLRSNKEILMTILEAFIYDPLVDW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.65
3 0.69
4 0.75
5 0.78
6 0.77
7 0.76
8 0.75
9 0.77
10 0.76
11 0.69
12 0.63
13 0.54
14 0.48
15 0.39
16 0.33
17 0.25
18 0.2
19 0.2
20 0.16
21 0.15
22 0.13
23 0.12
24 0.11
25 0.11
26 0.09
27 0.08
28 0.07
29 0.08
30 0.09
31 0.08
32 0.08
33 0.07
34 0.07
35 0.08
36 0.08
37 0.1
38 0.14
39 0.22
40 0.3
41 0.38
42 0.46
43 0.54
44 0.64
45 0.71
46 0.78
47 0.81
48 0.82
49 0.84
50 0.85
51 0.82
52 0.83
53 0.77
54 0.74
55 0.7
56 0.66
57 0.62
58 0.64
59 0.63
60 0.58
61 0.61
62 0.6
63 0.56
64 0.54
65 0.57
66 0.56
67 0.58
68 0.59
69 0.54
70 0.51
71 0.5
72 0.5
73 0.4
74 0.31
75 0.26
76 0.21
77 0.22
78 0.22
79 0.21
80 0.18
81 0.18
82 0.22
83 0.22
84 0.2
85 0.18
86 0.16
87 0.17
88 0.17
89 0.17
90 0.13
91 0.12
92 0.11
93 0.12
94 0.14
95 0.12
96 0.12
97 0.15
98 0.18
99 0.17
100 0.17
101 0.18
102 0.17
103 0.22
104 0.29
105 0.27
106 0.27
107 0.27
108 0.26
109 0.26
110 0.24
111 0.19
112 0.12
113 0.11
114 0.08
115 0.07
116 0.06
117 0.04
118 0.04
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.05
125 0.05
126 0.05
127 0.06
128 0.06
129 0.06
130 0.07
131 0.07
132 0.06
133 0.06
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.04
140 0.04
141 0.04
142 0.05
143 0.05
144 0.05
145 0.07
146 0.08
147 0.08
148 0.08
149 0.09
150 0.19
151 0.21
152 0.26
153 0.27
154 0.31
155 0.33
156 0.38
157 0.42
158 0.39
159 0.44
160 0.43
161 0.4
162 0.37
163 0.36
164 0.34
165 0.32
166 0.31
167 0.31
168 0.31
169 0.31
170 0.3
171 0.29
172 0.25
173 0.23
174 0.17
175 0.11
176 0.09
177 0.09
178 0.09
179 0.08
180 0.09
181 0.09
182 0.1
183 0.11
184 0.08
185 0.09
186 0.11
187 0.12
188 0.13
189 0.14
190 0.14
191 0.16
192 0.21
193 0.22
194 0.21
195 0.21
196 0.21
197 0.21
198 0.21
199 0.2
200 0.18
201 0.18
202 0.16
203 0.15
204 0.13
205 0.12
206 0.12
207 0.1
208 0.07