Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XT43

Protein Details
Accession A0A1Y1XT43    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
81-103DESIVKGQIKKKDKKKKKSKNKNBasic
NLS Segment(s)
PositionSequence
63-72KRKIIKKNIK
88-103QIKKKDKKKKKSKNKN
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
Amino Acid Sequences MVVKYLISKNASLTNYNDQKETVMDVAKRVDDLAIIKLISEQKEWIEFEKNLEQNKVRVEGEKRKIIKKNIKKEDEVNNDDESIVKGQIKKKDKKKKKSKNKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.42
4 0.4
5 0.33
6 0.32
7 0.3
8 0.28
9 0.2
10 0.17
11 0.16
12 0.17
13 0.18
14 0.17
15 0.17
16 0.14
17 0.12
18 0.09
19 0.1
20 0.1
21 0.09
22 0.09
23 0.09
24 0.11
25 0.13
26 0.13
27 0.12
28 0.12
29 0.11
30 0.14
31 0.14
32 0.14
33 0.16
34 0.15
35 0.18
36 0.23
37 0.25
38 0.24
39 0.26
40 0.25
41 0.23
42 0.24
43 0.24
44 0.18
45 0.2
46 0.25
47 0.32
48 0.37
49 0.43
50 0.45
51 0.49
52 0.55
53 0.61
54 0.65
55 0.66
56 0.71
57 0.74
58 0.75
59 0.72
60 0.72
61 0.72
62 0.71
63 0.65
64 0.57
65 0.48
66 0.43
67 0.39
68 0.33
69 0.25
70 0.17
71 0.14
72 0.14
73 0.18
74 0.23
75 0.33
76 0.42
77 0.5
78 0.6
79 0.7
80 0.78
81 0.85
82 0.9
83 0.93