Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2AL53

Protein Details
Accession A0A1Y2AL53    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
77-96NENERKVKKKIEKENESMKIHydrophilic
NLS Segment(s)
PositionSequence
81-141RKVKKKIEKENESMKIELEEEKKEKEKIKKDLELLRIEKGEKEKKELEKKNYIIEKIKKKR
201-212KKEKEKIKKDLE
214-224LRIEKEEKEKK
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
Pfam View protein in Pfam  
PF13637  Ank_4  
PROSITE View protein in PROSITE  
PS50297  ANK_REP_REGION  
PS50088  ANK_REPEAT  
Amino Acid Sequences MFKLLVEYSIEKGIKLIIDENDIENMISKKYYLCKLNNISEINYKFLKLIYFHKNKNIIEVIFSNSSYFLKKFNKINENERKVKKKIEKENESMKIELEEEKKEKEKIKKDLELLRIEKGEKEKKELEKKNYIIEKIKKKRDNNETLLTSECKQGNIEEVKKEKIEKENESMKIELENERKTKEKIEKENELIKIELEEEKKEKEKIKKDLELLRIEKEEKEKKELEKKNYIIEKYNNKRDNNETLLTSECKQDNIEEVKKLIHCRMNINKKNKDGDTPLLIACKNGNIELVKYLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.2
4 0.15
5 0.18
6 0.2
7 0.21
8 0.2
9 0.2
10 0.18
11 0.17
12 0.16
13 0.14
14 0.13
15 0.12
16 0.14
17 0.2
18 0.27
19 0.31
20 0.35
21 0.43
22 0.5
23 0.57
24 0.6
25 0.57
26 0.53
27 0.53
28 0.51
29 0.45
30 0.39
31 0.32
32 0.26
33 0.25
34 0.24
35 0.18
36 0.24
37 0.31
38 0.38
39 0.41
40 0.49
41 0.55
42 0.53
43 0.56
44 0.53
45 0.43
46 0.38
47 0.36
48 0.33
49 0.27
50 0.27
51 0.21
52 0.18
53 0.18
54 0.17
55 0.16
56 0.19
57 0.23
58 0.29
59 0.34
60 0.42
61 0.5
62 0.53
63 0.63
64 0.67
65 0.69
66 0.73
67 0.76
68 0.74
69 0.69
70 0.74
71 0.72
72 0.71
73 0.74
74 0.75
75 0.75
76 0.74
77 0.8
78 0.78
79 0.71
80 0.62
81 0.51
82 0.41
83 0.34
84 0.32
85 0.24
86 0.22
87 0.21
88 0.24
89 0.26
90 0.3
91 0.36
92 0.4
93 0.46
94 0.5
95 0.56
96 0.58
97 0.61
98 0.64
99 0.63
100 0.61
101 0.55
102 0.48
103 0.41
104 0.36
105 0.33
106 0.33
107 0.35
108 0.29
109 0.33
110 0.36
111 0.43
112 0.53
113 0.58
114 0.58
115 0.6
116 0.6
117 0.62
118 0.6
119 0.54
120 0.52
121 0.52
122 0.56
123 0.56
124 0.64
125 0.64
126 0.66
127 0.72
128 0.74
129 0.74
130 0.69
131 0.66
132 0.58
133 0.52
134 0.48
135 0.41
136 0.32
137 0.27
138 0.22
139 0.16
140 0.15
141 0.14
142 0.17
143 0.2
144 0.22
145 0.22
146 0.24
147 0.25
148 0.26
149 0.27
150 0.25
151 0.28
152 0.31
153 0.3
154 0.34
155 0.4
156 0.41
157 0.43
158 0.4
159 0.33
160 0.28
161 0.26
162 0.26
163 0.23
164 0.26
165 0.25
166 0.26
167 0.29
168 0.29
169 0.34
170 0.37
171 0.42
172 0.46
173 0.52
174 0.56
175 0.58
176 0.64
177 0.59
178 0.51
179 0.43
180 0.33
181 0.26
182 0.21
183 0.2
184 0.15
185 0.16
186 0.16
187 0.2
188 0.22
189 0.26
190 0.32
191 0.36
192 0.44
193 0.5
194 0.56
195 0.58
196 0.61
197 0.64
198 0.63
199 0.61
200 0.55
201 0.49
202 0.44
203 0.4
204 0.37
205 0.39
206 0.41
207 0.37
208 0.41
209 0.42
210 0.48
211 0.57
212 0.62
213 0.61
214 0.61
215 0.6
216 0.61
217 0.63
218 0.58
219 0.54
220 0.54
221 0.58
222 0.58
223 0.67
224 0.67
225 0.62
226 0.65
227 0.64
228 0.64
229 0.59
230 0.52
231 0.43
232 0.36
233 0.36
234 0.33
235 0.28
236 0.26
237 0.2
238 0.19
239 0.18
240 0.18
241 0.24
242 0.31
243 0.34
244 0.3
245 0.31
246 0.34
247 0.37
248 0.4
249 0.39
250 0.37
251 0.35
252 0.42
253 0.52
254 0.59
255 0.65
256 0.71
257 0.72
258 0.74
259 0.79
260 0.72
261 0.69
262 0.64
263 0.61
264 0.57
265 0.51
266 0.46
267 0.42
268 0.39
269 0.33
270 0.27
271 0.25
272 0.21
273 0.18
274 0.21
275 0.18
276 0.2
277 0.21