Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2B146

Protein Details
Accession A0A1Y2B146    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
76-98ETPKTGKGQKKAKPVNKDRFIPKBasic
NLS Segment(s)
PositionSequence
85-88KKAK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.833, cyto 5, cyto_pero 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR027248  Sm_D2  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0005829  C:cytosol  
GO:0030532  C:small nuclear ribonucleoprotein complex  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01720  Sm_D2  
Amino Acid Sequences MSAPEKPKSEMTEEELRKIEEEEFNTGPLSVLSQSVKNNTQILISCRNNRKLLARVKAFDRHMNMVLENVKEMWTETPKTGKGQKKAKPVNKDRFIPKMFLRGDSVILVLRNIQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.39
4 0.35
5 0.32
6 0.29
7 0.23
8 0.24
9 0.25
10 0.23
11 0.23
12 0.23
13 0.21
14 0.18
15 0.13
16 0.12
17 0.07
18 0.09
19 0.09
20 0.12
21 0.13
22 0.17
23 0.19
24 0.2
25 0.2
26 0.19
27 0.19
28 0.18
29 0.21
30 0.25
31 0.27
32 0.33
33 0.38
34 0.42
35 0.42
36 0.42
37 0.43
38 0.42
39 0.46
40 0.46
41 0.43
42 0.4
43 0.42
44 0.46
45 0.44
46 0.39
47 0.34
48 0.29
49 0.28
50 0.27
51 0.23
52 0.2
53 0.2
54 0.16
55 0.14
56 0.11
57 0.09
58 0.09
59 0.1
60 0.1
61 0.11
62 0.13
63 0.14
64 0.18
65 0.19
66 0.24
67 0.32
68 0.36
69 0.42
70 0.5
71 0.55
72 0.62
73 0.71
74 0.75
75 0.78
76 0.81
77 0.83
78 0.81
79 0.82
80 0.77
81 0.76
82 0.7
83 0.65
84 0.57
85 0.55
86 0.49
87 0.44
88 0.42
89 0.34
90 0.34
91 0.29
92 0.27
93 0.2
94 0.19
95 0.17