Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2E5S7

Protein Details
Accession A0A1Y2E5S7   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
80-107EKENKLLRKQLKKEKKARKNNLKIINNTHydrophilic
NLS Segment(s)
PositionSequence
73-100KKKIERIEKENKLLRKQLKKEKKARKNN
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
Pfam View protein in Pfam  
PF13637  Ank_4  
PROSITE View protein in PROSITE  
PS50297  ANK_REP_REGION  
PS50088  ANK_REPEAT  
Amino Acid Sequences MFKLLVEYSVERKIKIIVNEKDIEEKISKNLEFIHPEFIKLIYLYRNKNIIEVIFSENSYLLKKVIEYYDDVKKKIERIEKENKLLRKQLKKEKKARKNNLKIINNTKRDDKDTFLTYECQQGNIEKVKKLIHLGMDVNEKNKDGNTPLLIACKNGNIELVKYLLNYKEVKVTVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.37
3 0.43
4 0.39
5 0.45
6 0.48
7 0.48
8 0.49
9 0.45
10 0.41
11 0.33
12 0.29
13 0.26
14 0.29
15 0.28
16 0.24
17 0.26
18 0.27
19 0.3
20 0.3
21 0.35
22 0.29
23 0.3
24 0.29
25 0.27
26 0.23
27 0.18
28 0.18
29 0.17
30 0.23
31 0.25
32 0.28
33 0.32
34 0.31
35 0.32
36 0.32
37 0.25
38 0.21
39 0.2
40 0.2
41 0.16
42 0.16
43 0.15
44 0.14
45 0.15
46 0.14
47 0.12
48 0.08
49 0.07
50 0.08
51 0.09
52 0.1
53 0.11
54 0.12
55 0.15
56 0.24
57 0.26
58 0.26
59 0.26
60 0.26
61 0.28
62 0.32
63 0.36
64 0.31
65 0.37
66 0.47
67 0.5
68 0.56
69 0.58
70 0.56
71 0.52
72 0.55
73 0.55
74 0.53
75 0.56
76 0.6
77 0.65
78 0.7
79 0.77
80 0.81
81 0.84
82 0.86
83 0.89
84 0.9
85 0.9
86 0.89
87 0.89
88 0.84
89 0.8
90 0.79
91 0.78
92 0.72
93 0.64
94 0.61
95 0.53
96 0.52
97 0.48
98 0.4
99 0.35
100 0.32
101 0.32
102 0.27
103 0.28
104 0.24
105 0.29
106 0.25
107 0.22
108 0.2
109 0.19
110 0.22
111 0.28
112 0.3
113 0.24
114 0.26
115 0.27
116 0.28
117 0.29
118 0.27
119 0.22
120 0.22
121 0.22
122 0.23
123 0.29
124 0.28
125 0.29
126 0.27
127 0.25
128 0.23
129 0.22
130 0.21
131 0.16
132 0.2
133 0.19
134 0.2
135 0.21
136 0.25
137 0.25
138 0.24
139 0.22
140 0.21
141 0.2
142 0.18
143 0.21
144 0.17
145 0.18
146 0.18
147 0.19
148 0.16
149 0.16
150 0.19
151 0.17
152 0.2
153 0.21
154 0.21
155 0.26