Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2E8X1

Protein Details
Accession A0A1Y2E8X1    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
89-113LKNNNPVKSRKGKKIKKLVKIIILIHydrophilic
NLS Segment(s)
PositionSequence
96-106KSRKGKKIKKL
Subcellular Location(s) nucl 15, mito 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MNSKIFIDEYSNSKFTPENNNKSFKRDTFDSIYEINNNIHNYKKKIDNNNENNIDNLPSTSNNIPNCKIRVNTEISNFKFKKFNSSEFLKNNNPVKSRKGKKIKKLVKIIILII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.34
4 0.39
5 0.43
6 0.47
7 0.57
8 0.57
9 0.61
10 0.64
11 0.55
12 0.52
13 0.46
14 0.46
15 0.43
16 0.44
17 0.41
18 0.36
19 0.35
20 0.29
21 0.27
22 0.22
23 0.19
24 0.19
25 0.17
26 0.22
27 0.25
28 0.27
29 0.29
30 0.37
31 0.41
32 0.49
33 0.58
34 0.63
35 0.65
36 0.71
37 0.7
38 0.62
39 0.55
40 0.46
41 0.36
42 0.26
43 0.19
44 0.11
45 0.08
46 0.1
47 0.11
48 0.15
49 0.16
50 0.19
51 0.21
52 0.23
53 0.25
54 0.25
55 0.25
56 0.24
57 0.27
58 0.3
59 0.31
60 0.34
61 0.4
62 0.4
63 0.49
64 0.46
65 0.43
66 0.43
67 0.4
68 0.44
69 0.4
70 0.43
71 0.39
72 0.44
73 0.5
74 0.5
75 0.56
76 0.51
77 0.54
78 0.55
79 0.56
80 0.55
81 0.51
82 0.54
83 0.58
84 0.62
85 0.65
86 0.7
87 0.73
88 0.79
89 0.87
90 0.88
91 0.87
92 0.89
93 0.86
94 0.83