Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YNQ7

Protein Details
Accession A0A1Y1YNQ7   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-32KSEENKEDKKEDKKEDKKEDKKDEKESEMAcidic
NLS Segment(s)
PositionSequence
13-24KEDKKEDKKEDK
Subcellular Location(s) nucl 21, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000740  GrpE  
IPR013805  GrpE_coiled_coil  
IPR009012  GrpE_head  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0000774  F:adenyl-nucleotide exchange factor activity  
GO:0042803  F:protein homodimerization activity  
GO:0051087  F:protein-folding chaperone binding  
GO:0006457  P:protein folding  
Pfam View protein in Pfam  
PF01025  GrpE  
PROSITE View protein in PROSITE  
PS01071  GRPE  
CDD cd00446  GrpE  
Amino Acid Sequences REEKSEENKEDKKEDKKEDKKEDKKDEKESEMDPAVKKLLESKDKKISDLQNAYKRALADTENIRERTRKEIQKSTQFAIQKFAKDLLDISDILKMALESVPEEKREDKSDNILYSLFTGVSMTRTQLLNTFKKHGLEMFNPLGEVFDANKHQAMFQTPMADKEPGIVIAVQKEGYILNGRILRPAQVGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.72
3 0.76
4 0.81
5 0.86
6 0.89
7 0.89
8 0.9
9 0.91
10 0.9
11 0.88
12 0.88
13 0.83
14 0.77
15 0.7
16 0.61
17 0.56
18 0.49
19 0.45
20 0.36
21 0.31
22 0.28
23 0.24
24 0.23
25 0.24
26 0.28
27 0.33
28 0.37
29 0.43
30 0.51
31 0.52
32 0.54
33 0.54
34 0.52
35 0.51
36 0.55
37 0.56
38 0.54
39 0.56
40 0.55
41 0.5
42 0.45
43 0.36
44 0.29
45 0.22
46 0.19
47 0.21
48 0.26
49 0.29
50 0.31
51 0.31
52 0.32
53 0.32
54 0.35
55 0.39
56 0.4
57 0.42
58 0.5
59 0.56
60 0.63
61 0.65
62 0.59
63 0.55
64 0.51
65 0.45
66 0.42
67 0.37
68 0.29
69 0.26
70 0.26
71 0.21
72 0.18
73 0.17
74 0.13
75 0.12
76 0.11
77 0.11
78 0.1
79 0.1
80 0.1
81 0.09
82 0.07
83 0.06
84 0.06
85 0.05
86 0.05
87 0.08
88 0.09
89 0.1
90 0.12
91 0.13
92 0.15
93 0.19
94 0.2
95 0.19
96 0.23
97 0.26
98 0.25
99 0.25
100 0.23
101 0.19
102 0.17
103 0.16
104 0.11
105 0.07
106 0.06
107 0.06
108 0.07
109 0.07
110 0.07
111 0.09
112 0.09
113 0.1
114 0.15
115 0.21
116 0.24
117 0.27
118 0.31
119 0.31
120 0.32
121 0.33
122 0.31
123 0.3
124 0.26
125 0.3
126 0.27
127 0.25
128 0.24
129 0.23
130 0.2
131 0.15
132 0.14
133 0.09
134 0.1
135 0.12
136 0.13
137 0.15
138 0.15
139 0.15
140 0.16
141 0.19
142 0.19
143 0.19
144 0.24
145 0.23
146 0.25
147 0.28
148 0.27
149 0.23
150 0.21
151 0.2
152 0.14
153 0.15
154 0.13
155 0.12
156 0.13
157 0.14
158 0.13
159 0.11
160 0.11
161 0.1
162 0.12
163 0.15
164 0.14
165 0.19
166 0.23
167 0.24
168 0.28
169 0.29
170 0.29