Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2AT53

Protein Details
Accession A0A1Y2AT53   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
82-109LKINQIIKRNKLRKRSLKNNINKSKNETHydrophilic
NLS Segment(s)
PositionSequence
90-96RNKLRKR
Subcellular Location(s) nucl 14, cyto_nucl 12.333, cyto 8.5, cyto_mito 6.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR036861  Endochitinase-like_sf  
Gene Ontology GO:0008061  F:chitin binding  
CDD cd00035  ChtBD1  
Amino Acid Sequences MDVVEMNMVFGPGSQCCSKYGYSGKGSDYCGNGCKSSYGSCNSGSSSSSSSIISIKEDVKKLKEGEVKNESGENSFINSEILKINQIIKRNKLRKRSLKNNINKSKNETIYEIDEEENYNGDNDDIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.15
4 0.19
5 0.18
6 0.23
7 0.28
8 0.31
9 0.34
10 0.35
11 0.37
12 0.38
13 0.41
14 0.38
15 0.34
16 0.29
17 0.29
18 0.28
19 0.25
20 0.22
21 0.2
22 0.18
23 0.19
24 0.2
25 0.2
26 0.2
27 0.21
28 0.22
29 0.22
30 0.21
31 0.19
32 0.17
33 0.15
34 0.14
35 0.14
36 0.13
37 0.12
38 0.12
39 0.12
40 0.11
41 0.11
42 0.13
43 0.15
44 0.18
45 0.19
46 0.2
47 0.23
48 0.23
49 0.27
50 0.31
51 0.29
52 0.33
53 0.36
54 0.35
55 0.32
56 0.32
57 0.26
58 0.21
59 0.2
60 0.13
61 0.1
62 0.09
63 0.09
64 0.08
65 0.07
66 0.08
67 0.08
68 0.08
69 0.08
70 0.08
71 0.14
72 0.16
73 0.24
74 0.28
75 0.35
76 0.45
77 0.54
78 0.6
79 0.65
80 0.73
81 0.76
82 0.82
83 0.85
84 0.85
85 0.87
86 0.9
87 0.91
88 0.91
89 0.88
90 0.81
91 0.78
92 0.76
93 0.7
94 0.63
95 0.55
96 0.48
97 0.45
98 0.43
99 0.37
100 0.29
101 0.25
102 0.23
103 0.21
104 0.18
105 0.14
106 0.12
107 0.1