Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CQN4

Protein Details
Accession A0A1Y2CQN4    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
105-130EEKPKEEEKKEEKKEEKKEEKKEETSAcidic
NLS Segment(s)
PositionSequence
73-126KKKKAPAAAAPKPSTSAPEQKKEEPKAEEKKAEEKPKEEEKKEEKKEEKKEEKK
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004806  Rad23  
IPR006636  STI1_HS-bd  
IPR015940  UBA  
IPR009060  UBA-like_sf  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
IPR015360  XPC-bd  
IPR036353  XPC-bd_sf  
Gene Ontology GO:0005829  C:cytosol  
GO:0005654  C:nucleoplasm  
GO:0003684  F:damaged DNA binding  
GO:0031593  F:polyubiquitin modification-dependent protein binding  
GO:0043130  F:ubiquitin binding  
GO:0006289  P:nucleotide-excision repair  
GO:0043161  P:proteasome-mediated ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF00627  UBA  
PF00240  ubiquitin  
PF09280  XPC-binding  
PROSITE View protein in PROSITE  
PS50030  UBA  
PS50053  UBIQUITIN_2  
CDD cd14280  UBA1_Rad23_like  
cd14281  UBA2_Rad23_like  
cd01805  Ubl_Rad23  
Amino Acid Sequences MKLQFKTLSRATFTIEAEPSEKVIDLKKKVSEVQGFDVDRQNLIYKGKILSDDVTVEECHFAEKDFIVVMEMKKKKAPAAAAPKPSTSAPEQKKEEPKAEEKKAEEKPKEEEKKEEKKEEKKEEKKEETSAPAPAPAAAETTSSQPAASNEITGEAYETAVNNLVEMGFEKEQVIKAMRASFNNPDRAAEYLMTGIPEHLLPQNPPPQQAAQAPAAAQPAQNAAAAPDPNSNQPVNLFEAAANAARPASAAPAGQNELAFLNNNPQFQRVRELIHSNPQLLQPLLQQLGQSNPELMEVISANPEAFVRLLEEGMGGEQQGAGNPHGGAVPIQISQEEAEAITRLEALGFERSLVIEAYFACDKDEELAANYLFNTQNENWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.34
3 0.31
4 0.29
5 0.28
6 0.24
7 0.2
8 0.19
9 0.15
10 0.21
11 0.28
12 0.31
13 0.36
14 0.39
15 0.42
16 0.46
17 0.52
18 0.52
19 0.48
20 0.49
21 0.51
22 0.48
23 0.47
24 0.5
25 0.42
26 0.36
27 0.33
28 0.29
29 0.24
30 0.25
31 0.24
32 0.2
33 0.21
34 0.23
35 0.23
36 0.23
37 0.21
38 0.21
39 0.2
40 0.19
41 0.19
42 0.17
43 0.16
44 0.15
45 0.13
46 0.13
47 0.12
48 0.11
49 0.11
50 0.1
51 0.11
52 0.09
53 0.1
54 0.1
55 0.12
56 0.14
57 0.21
58 0.24
59 0.26
60 0.28
61 0.3
62 0.31
63 0.33
64 0.36
65 0.36
66 0.44
67 0.51
68 0.56
69 0.57
70 0.54
71 0.51
72 0.47
73 0.41
74 0.35
75 0.37
76 0.35
77 0.42
78 0.47
79 0.53
80 0.62
81 0.63
82 0.64
83 0.6
84 0.63
85 0.64
86 0.66
87 0.63
88 0.57
89 0.61
90 0.63
91 0.67
92 0.61
93 0.55
94 0.55
95 0.6
96 0.66
97 0.59
98 0.6
99 0.6
100 0.67
101 0.71
102 0.74
103 0.72
104 0.73
105 0.8
106 0.82
107 0.83
108 0.82
109 0.84
110 0.85
111 0.84
112 0.78
113 0.73
114 0.65
115 0.6
116 0.52
117 0.45
118 0.35
119 0.29
120 0.25
121 0.21
122 0.17
123 0.12
124 0.11
125 0.08
126 0.09
127 0.09
128 0.11
129 0.12
130 0.11
131 0.11
132 0.1
133 0.11
134 0.13
135 0.13
136 0.11
137 0.1
138 0.11
139 0.11
140 0.1
141 0.1
142 0.06
143 0.06
144 0.06
145 0.06
146 0.05
147 0.07
148 0.07
149 0.06
150 0.06
151 0.05
152 0.05
153 0.06
154 0.08
155 0.07
156 0.07
157 0.08
158 0.08
159 0.09
160 0.11
161 0.11
162 0.09
163 0.1
164 0.15
165 0.16
166 0.17
167 0.19
168 0.25
169 0.27
170 0.31
171 0.3
172 0.25
173 0.25
174 0.25
175 0.23
176 0.16
177 0.12
178 0.09
179 0.09
180 0.08
181 0.08
182 0.06
183 0.05
184 0.05
185 0.06
186 0.07
187 0.07
188 0.08
189 0.12
190 0.2
191 0.2
192 0.22
193 0.22
194 0.21
195 0.23
196 0.24
197 0.24
198 0.17
199 0.17
200 0.16
201 0.16
202 0.16
203 0.13
204 0.12
205 0.09
206 0.08
207 0.09
208 0.08
209 0.07
210 0.07
211 0.09
212 0.09
213 0.1
214 0.11
215 0.11
216 0.13
217 0.16
218 0.15
219 0.13
220 0.14
221 0.14
222 0.15
223 0.14
224 0.13
225 0.1
226 0.11
227 0.12
228 0.11
229 0.09
230 0.06
231 0.06
232 0.05
233 0.05
234 0.05
235 0.05
236 0.06
237 0.06
238 0.07
239 0.09
240 0.11
241 0.11
242 0.11
243 0.1
244 0.1
245 0.1
246 0.1
247 0.08
248 0.14
249 0.16
250 0.19
251 0.19
252 0.21
253 0.22
254 0.23
255 0.29
256 0.23
257 0.24
258 0.26
259 0.31
260 0.31
261 0.38
262 0.39
263 0.34
264 0.34
265 0.32
266 0.3
267 0.25
268 0.23
269 0.16
270 0.18
271 0.18
272 0.17
273 0.16
274 0.15
275 0.18
276 0.19
277 0.17
278 0.14
279 0.13
280 0.13
281 0.13
282 0.11
283 0.09
284 0.08
285 0.08
286 0.08
287 0.08
288 0.08
289 0.08
290 0.08
291 0.07
292 0.07
293 0.07
294 0.07
295 0.08
296 0.08
297 0.07
298 0.08
299 0.07
300 0.07
301 0.07
302 0.06
303 0.05
304 0.05
305 0.05
306 0.07
307 0.09
308 0.09
309 0.1
310 0.1
311 0.11
312 0.1
313 0.11
314 0.09
315 0.09
316 0.1
317 0.09
318 0.1
319 0.09
320 0.1
321 0.1
322 0.1
323 0.09
324 0.08
325 0.08
326 0.08
327 0.08
328 0.08
329 0.07
330 0.07
331 0.06
332 0.07
333 0.08
334 0.11
335 0.11
336 0.11
337 0.12
338 0.12
339 0.13
340 0.13
341 0.11
342 0.08
343 0.08
344 0.13
345 0.14
346 0.14
347 0.14
348 0.14
349 0.14
350 0.16
351 0.17
352 0.13
353 0.15
354 0.18
355 0.17
356 0.17
357 0.17
358 0.19
359 0.19
360 0.18
361 0.22