Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CFF3

Protein Details
Accession A0A1Y2CFF3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
40-66AQAFFFPKKQENKKPDKKPDYKKDFLEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, plas 7, E.R. 6, cyto 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNCGDCLKKNYNNDKPLSKRIFHVILVFFVVWQIGFSHLAQAFFFPKKQENKKPDKKPDYKKDFLEKIVIVHVTKTSFVFDFLIGVILFLYKIIRMLIKKAKSFIQNNRYIMKILYNNNNNNNNNNINNTNNNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.73
3 0.76
4 0.72
5 0.63
6 0.56
7 0.55
8 0.53
9 0.45
10 0.43
11 0.34
12 0.29
13 0.29
14 0.25
15 0.18
16 0.15
17 0.13
18 0.08
19 0.07
20 0.06
21 0.06
22 0.08
23 0.08
24 0.12
25 0.13
26 0.14
27 0.14
28 0.15
29 0.16
30 0.16
31 0.17
32 0.15
33 0.21
34 0.29
35 0.38
36 0.47
37 0.53
38 0.63
39 0.72
40 0.8
41 0.85
42 0.86
43 0.87
44 0.88
45 0.89
46 0.87
47 0.82
48 0.77
49 0.74
50 0.66
51 0.58
52 0.51
53 0.4
54 0.31
55 0.28
56 0.24
57 0.15
58 0.13
59 0.12
60 0.09
61 0.1
62 0.09
63 0.09
64 0.08
65 0.09
66 0.09
67 0.08
68 0.08
69 0.07
70 0.08
71 0.07
72 0.06
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.03
79 0.04
80 0.04
81 0.08
82 0.09
83 0.16
84 0.24
85 0.29
86 0.32
87 0.34
88 0.38
89 0.43
90 0.51
91 0.54
92 0.56
93 0.58
94 0.59
95 0.59
96 0.55
97 0.48
98 0.41
99 0.37
100 0.34
101 0.32
102 0.39
103 0.45
104 0.5
105 0.58
106 0.66
107 0.62
108 0.6
109 0.59
110 0.55
111 0.49
112 0.48
113 0.43
114 0.39