Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZD10

Protein Details
Accession A0A1Y1ZD10   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-29NFMNKRYFKGLQKRNNIQHDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 11, cyto 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR024079  MetalloPept_cat_dom_sf  
IPR000718  Peptidase_M13  
IPR008753  Peptidase_M13_N  
Gene Ontology GO:0004222  F:metalloendopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF05649  Peptidase_M13_N  
PROSITE View protein in PROSITE  
PS51885  NEPRILYSIN  
Amino Acid Sequences MSKFKHHSNFMNKRYFKGLQKRNNIQHDEIECKINKAEECVLNLQKIMPIAISRYYVQKYFDDNIKIKVKEMFENIEEAMIDRIPKIEWLDDEIKEYGIQKVLSMKNIIGYTDDIMNPKKLYQYYKNLEINNYFDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.64
3 0.62
4 0.63
5 0.64
6 0.64
7 0.73
8 0.79
9 0.81
10 0.84
11 0.79
12 0.71
13 0.68
14 0.62
15 0.57
16 0.49
17 0.45
18 0.36
19 0.32
20 0.31
21 0.27
22 0.23
23 0.21
24 0.25
25 0.21
26 0.24
27 0.28
28 0.28
29 0.25
30 0.25
31 0.22
32 0.18
33 0.16
34 0.13
35 0.08
36 0.07
37 0.08
38 0.09
39 0.11
40 0.1
41 0.14
42 0.15
43 0.16
44 0.18
45 0.18
46 0.2
47 0.21
48 0.24
49 0.25
50 0.25
51 0.3
52 0.33
53 0.32
54 0.29
55 0.3
56 0.28
57 0.25
58 0.26
59 0.22
60 0.17
61 0.18
62 0.17
63 0.13
64 0.12
65 0.1
66 0.09
67 0.07
68 0.06
69 0.05
70 0.06
71 0.05
72 0.07
73 0.08
74 0.08
75 0.08
76 0.14
77 0.17
78 0.17
79 0.19
80 0.19
81 0.18
82 0.17
83 0.18
84 0.14
85 0.13
86 0.13
87 0.11
88 0.18
89 0.19
90 0.21
91 0.22
92 0.2
93 0.22
94 0.23
95 0.22
96 0.16
97 0.16
98 0.15
99 0.16
100 0.17
101 0.16
102 0.18
103 0.21
104 0.2
105 0.2
106 0.24
107 0.25
108 0.32
109 0.37
110 0.45
111 0.49
112 0.58
113 0.63
114 0.6
115 0.61
116 0.57