Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2ALJ3

Protein Details
Accession A0A1Y2ALJ3   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-31VENNNVVKTKRKRSSKACDVCHKKKIKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR020448  Maltose_ferment_reg_DNA-bd  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MIEEVENNNVVKTKRKRSSKACDVCHKKKIKCDGNNPCSNCIDSKIPCVYSPRTKKRGPRAGYIGIIEKKLRDMES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.59
3 0.67
4 0.74
5 0.83
6 0.84
7 0.85
8 0.82
9 0.83
10 0.84
11 0.82
12 0.81
13 0.79
14 0.72
15 0.7
16 0.73
17 0.72
18 0.7
19 0.73
20 0.75
21 0.75
22 0.79
23 0.72
24 0.64
25 0.55
26 0.48
27 0.38
28 0.3
29 0.25
30 0.19
31 0.22
32 0.22
33 0.22
34 0.22
35 0.26
36 0.28
37 0.34
38 0.44
39 0.49
40 0.54
41 0.59
42 0.67
43 0.74
44 0.78
45 0.73
46 0.71
47 0.69
48 0.67
49 0.64
50 0.57
51 0.54
52 0.46
53 0.44
54 0.37
55 0.3
56 0.28