Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2F5U1

Protein Details
Accession A0A1Y2F5U1    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
23-42TELPPKKPLKQIKRAPKSAKHydrophilic
NLS Segment(s)
PositionSequence
27-47PKKPLKQIKRAPKSAKAPPSE
52-66QEAKKAAKKLNTKIP
Subcellular Location(s) extr 10, cyto 7, mito 4, pero 2, E.R. 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MNTKTLLLAILAFFLVISVASATELPPKKPLKQIKRAPKSAKAPPSEYIPQQEAKKAAKKLNTKIPPKGSDEIPKTRDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.03
4 0.04
5 0.03
6 0.03
7 0.04
8 0.04
9 0.05
10 0.13
11 0.14
12 0.15
13 0.22
14 0.25
15 0.29
16 0.37
17 0.47
18 0.49
19 0.58
20 0.66
21 0.7
22 0.76
23 0.81
24 0.78
25 0.75
26 0.72
27 0.69
28 0.67
29 0.6
30 0.54
31 0.47
32 0.48
33 0.43
34 0.38
35 0.34
36 0.29
37 0.3
38 0.28
39 0.3
40 0.28
41 0.3
42 0.36
43 0.37
44 0.4
45 0.44
46 0.51
47 0.55
48 0.62
49 0.66
50 0.66
51 0.69
52 0.72
53 0.69
54 0.67
55 0.64
56 0.58
57 0.59
58 0.59
59 0.59
60 0.54