Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2BWV0

Protein Details
Accession A0A1Y2BWV0    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-79NSRPNSQKNKSNKINNDNNKDDHydrophilic
NLS Segment(s)
PositionSequence
46-57RDGKKSRPNSKS
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MGKHEKPKLLPEIPRENSLITSNQITKKELTVNRNNKSSRAANGLRDGKKSRPNSKSNSRPNSQKNKSNKINNDNNKDDLEHNITIDPKTNNIEIYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.54
3 0.46
4 0.4
5 0.36
6 0.3
7 0.21
8 0.22
9 0.25
10 0.28
11 0.29
12 0.29
13 0.28
14 0.28
15 0.34
16 0.36
17 0.39
18 0.44
19 0.52
20 0.55
21 0.61
22 0.59
23 0.53
24 0.53
25 0.47
26 0.39
27 0.37
28 0.35
29 0.3
30 0.37
31 0.43
32 0.39
33 0.4
34 0.4
35 0.37
36 0.43
37 0.47
38 0.49
39 0.49
40 0.54
41 0.58
42 0.65
43 0.71
44 0.73
45 0.74
46 0.69
47 0.7
48 0.74
49 0.77
50 0.74
51 0.72
52 0.71
53 0.74
54 0.79
55 0.79
56 0.79
57 0.77
58 0.81
59 0.81
60 0.81
61 0.75
62 0.68
63 0.6
64 0.53
65 0.45
66 0.4
67 0.36
68 0.28
69 0.25
70 0.24
71 0.25
72 0.23
73 0.27
74 0.23
75 0.2
76 0.24
77 0.24