Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZAW3

Protein Details
Accession A0A1Y1ZAW3    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MKINSKVNKIRKVEKQPIKKNFKKIEAKVHydrophilic
96-118SLLGTKKSKKKVKTNDNSKKEKAHydrophilic
NLS Segment(s)
PositionSequence
11-23RKVEKQPIKKNFK
101-110KKSKKKVKTN
Subcellular Location(s) nucl 17, cyto 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MKINSKVNKIRKVEKQPIKKNFKKIEAKVVNSVTKSIKSTNTDDIDLIFSKKKTTPVNDIDLIFSKKKSLTSLKSSDKVSKNTVVKKEENNSKIMSLLGTKKSKKKVKTNDNSKKEKAGLNDNSKIVIANTDIKKNKNAYKPKDDDGFGDSRGLHSERRTEDGLRIFSMEDLRIGEGEGDTPLCPFDCNCCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.85
4 0.89
5 0.91
6 0.88
7 0.88
8 0.86
9 0.86
10 0.85
11 0.79
12 0.8
13 0.77
14 0.74
15 0.7
16 0.67
17 0.61
18 0.51
19 0.5
20 0.41
21 0.36
22 0.34
23 0.3
24 0.3
25 0.3
26 0.34
27 0.38
28 0.38
29 0.36
30 0.34
31 0.32
32 0.29
33 0.25
34 0.23
35 0.19
36 0.16
37 0.18
38 0.2
39 0.25
40 0.29
41 0.33
42 0.39
43 0.41
44 0.46
45 0.46
46 0.44
47 0.4
48 0.38
49 0.36
50 0.28
51 0.23
52 0.2
53 0.18
54 0.19
55 0.22
56 0.25
57 0.27
58 0.34
59 0.42
60 0.46
61 0.48
62 0.49
63 0.52
64 0.5
65 0.47
66 0.44
67 0.43
68 0.43
69 0.46
70 0.49
71 0.46
72 0.45
73 0.46
74 0.5
75 0.51
76 0.47
77 0.42
78 0.37
79 0.32
80 0.29
81 0.25
82 0.18
83 0.12
84 0.14
85 0.17
86 0.22
87 0.25
88 0.31
89 0.4
90 0.47
91 0.52
92 0.59
93 0.63
94 0.69
95 0.77
96 0.82
97 0.84
98 0.86
99 0.86
100 0.78
101 0.71
102 0.63
103 0.55
104 0.47
105 0.45
106 0.45
107 0.44
108 0.46
109 0.42
110 0.4
111 0.37
112 0.34
113 0.24
114 0.17
115 0.12
116 0.15
117 0.17
118 0.24
119 0.27
120 0.29
121 0.34
122 0.39
123 0.45
124 0.47
125 0.55
126 0.55
127 0.63
128 0.66
129 0.66
130 0.66
131 0.59
132 0.51
133 0.46
134 0.4
135 0.3
136 0.27
137 0.22
138 0.18
139 0.2
140 0.2
141 0.18
142 0.18
143 0.24
144 0.25
145 0.29
146 0.31
147 0.3
148 0.34
149 0.37
150 0.37
151 0.31
152 0.29
153 0.25
154 0.24
155 0.25
156 0.19
157 0.14
158 0.13
159 0.13
160 0.12
161 0.12
162 0.11
163 0.09
164 0.09
165 0.09
166 0.09
167 0.08
168 0.08
169 0.09
170 0.09
171 0.1
172 0.1