Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2FKS6

Protein Details
Accession A0A1Y2FKS6    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MNSKKISKKRKEKKKEIVLYKIIIHydrophilic
NLS Segment(s)
PositionSequence
4-15KKISKKRKEKKK
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 9.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000873  AMP-dep_Synth/Lig_com  
IPR042099  ANL_N_sf  
Pfam View protein in Pfam  
PF00501  AMP-binding  
Amino Acid Sequences MNSKKISKKRKEKKKEIVLYKIIIKGKNIYNVLSISSFSFDISHYEITFSLVHGLKIILVDDILNNDTELLTKKKFIIENNVEFIDTTPTRFKLFMENANFYTEVLPIIKVVMFLGEELPIELCRSIHKYSKCRIYNGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.94
3 0.92
4 0.9
5 0.84
6 0.77
7 0.7
8 0.66
9 0.59
10 0.5
11 0.42
12 0.39
13 0.38
14 0.41
15 0.38
16 0.32
17 0.3
18 0.29
19 0.29
20 0.23
21 0.2
22 0.13
23 0.13
24 0.12
25 0.1
26 0.1
27 0.09
28 0.1
29 0.12
30 0.13
31 0.11
32 0.12
33 0.11
34 0.13
35 0.13
36 0.11
37 0.13
38 0.12
39 0.12
40 0.11
41 0.11
42 0.09
43 0.09
44 0.09
45 0.05
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.07
57 0.09
58 0.09
59 0.1
60 0.11
61 0.14
62 0.17
63 0.18
64 0.26
65 0.29
66 0.32
67 0.34
68 0.33
69 0.3
70 0.27
71 0.26
72 0.22
73 0.15
74 0.15
75 0.15
76 0.16
77 0.17
78 0.17
79 0.17
80 0.2
81 0.23
82 0.29
83 0.32
84 0.34
85 0.34
86 0.36
87 0.35
88 0.27
89 0.25
90 0.17
91 0.13
92 0.1
93 0.09
94 0.07
95 0.08
96 0.07
97 0.07
98 0.07
99 0.06
100 0.06
101 0.06
102 0.07
103 0.06
104 0.06
105 0.07
106 0.08
107 0.07
108 0.08
109 0.08
110 0.08
111 0.12
112 0.17
113 0.21
114 0.28
115 0.36
116 0.43
117 0.52
118 0.62
119 0.63