Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2FCK4

Protein Details
Accession A0A1Y2FCK4    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
53-81YFVKNEQKERNVKRKEKYRLKIIKEQRNYHydrophilic
NLS Segment(s)
PositionSequence
65-71KRKEKYR
Subcellular Location(s) nucl 17, cyto_nucl 12.5, cyto 6, mito 4
Family & Domain DBs
Amino Acid Sequences MINSENYFVYMYFIKSILINNEITYFKNVLIPGFRLLQYYIQSVKRIFIVYDYFVKNEQKERNVKRKEKYRLKIIKEQRNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.14
4 0.14
5 0.15
6 0.14
7 0.14
8 0.16
9 0.17
10 0.17
11 0.18
12 0.16
13 0.14
14 0.16
15 0.16
16 0.14
17 0.15
18 0.15
19 0.14
20 0.15
21 0.15
22 0.13
23 0.13
24 0.14
25 0.14
26 0.15
27 0.16
28 0.16
29 0.17
30 0.17
31 0.17
32 0.16
33 0.15
34 0.13
35 0.12
36 0.12
37 0.13
38 0.18
39 0.18
40 0.18
41 0.2
42 0.23
43 0.23
44 0.28
45 0.31
46 0.34
47 0.43
48 0.52
49 0.6
50 0.67
51 0.74
52 0.76
53 0.81
54 0.85
55 0.86
56 0.85
57 0.85
58 0.85
59 0.85
60 0.85
61 0.85