Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EN68

Protein Details
Accession A0A1Y2EN68    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
104-123NEKNEIVEEKPKKPRRKVYFBasic
NLS Segment(s)
PositionSequence
113-120KPKKPRRK
Subcellular Location(s) nucl 15, mito_nucl 12.5, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR032640  AMPK1_CBM  
IPR013783  Ig-like_fold  
IPR014756  Ig_E-set  
Pfam View protein in Pfam  
PF16561  AMPK1_CBM  
CDD cd02859  E_set_AMPKbeta_like_N  
Amino Acid Sequences MPIIQYKITYPSRYASSVRLVGDFGTWSGWVDMKQDKKGYTSNLFVQEGTTIKYKFFVDGKHWGFDPTRNSTTDEEGHVCNIECVRNRPSDSEESSESESINNNEKNEIVEEKPKKPRRKVYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.32
3 0.32
4 0.34
5 0.33
6 0.29
7 0.26
8 0.22
9 0.21
10 0.18
11 0.12
12 0.09
13 0.08
14 0.08
15 0.08
16 0.09
17 0.08
18 0.11
19 0.16
20 0.2
21 0.24
22 0.27
23 0.27
24 0.29
25 0.32
26 0.34
27 0.33
28 0.32
29 0.32
30 0.33
31 0.33
32 0.3
33 0.27
34 0.23
35 0.19
36 0.18
37 0.17
38 0.12
39 0.12
40 0.14
41 0.14
42 0.14
43 0.15
44 0.15
45 0.16
46 0.25
47 0.27
48 0.26
49 0.26
50 0.25
51 0.24
52 0.26
53 0.26
54 0.23
55 0.24
56 0.24
57 0.27
58 0.27
59 0.29
60 0.27
61 0.24
62 0.2
63 0.18
64 0.18
65 0.15
66 0.14
67 0.12
68 0.11
69 0.13
70 0.13
71 0.17
72 0.2
73 0.24
74 0.25
75 0.27
76 0.31
77 0.34
78 0.35
79 0.35
80 0.34
81 0.33
82 0.34
83 0.32
84 0.27
85 0.22
86 0.21
87 0.19
88 0.25
89 0.24
90 0.22
91 0.23
92 0.23
93 0.24
94 0.24
95 0.26
96 0.22
97 0.29
98 0.34
99 0.42
100 0.52
101 0.6
102 0.67
103 0.74