Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0EX67

Protein Details
Accession H0EX67    Localization Confidence High Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-35SPTSLYNQHRSRRKLEKKAKLYKEMKRRDYIHydrophilic
191-224EAERKETERLRKERDEKKDKRKKELEERRKAISEBasic
NLS Segment(s)
PositionSequence
14-32RSRRKLEKKAKLYKEMKRR
194-229RKETERLRKERDEKKDKRKKELEERRKAISEKRAKK
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR025066  CCDC174-like  
Pfam View protein in Pfam  
PF13300  DUF4078  
Amino Acid Sequences MAPPSPTSLYNQHRSRRKLEKKAKLYKEMKRRDYIPKEGEEELVDFDRKWVDRDAKGEVSSSDSEVDDGGEMVDYEDEYGRLRRGTKADAERMERRKLNKVLGQEELDRISARPAQPEKVIYGDTVQTLAFNPDEEIHEKMEALAGKRDRSMTPPEQRHYEADKEFRIRGVGFYNFSKDEEGRKREMEALEAERKETERLRKERDEKKDKRKKELEERRKAISEKRAKKQAESFLDNLGADLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.76
4 0.79
5 0.8
6 0.83
7 0.85
8 0.86
9 0.91
10 0.91
11 0.9
12 0.89
13 0.87
14 0.87
15 0.86
16 0.83
17 0.78
18 0.76
19 0.76
20 0.75
21 0.75
22 0.7
23 0.64
24 0.6
25 0.55
26 0.5
27 0.41
28 0.33
29 0.27
30 0.23
31 0.19
32 0.15
33 0.15
34 0.18
35 0.17
36 0.18
37 0.22
38 0.26
39 0.28
40 0.31
41 0.36
42 0.35
43 0.35
44 0.34
45 0.28
46 0.26
47 0.23
48 0.21
49 0.17
50 0.13
51 0.13
52 0.12
53 0.12
54 0.07
55 0.06
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.06
66 0.07
67 0.08
68 0.1
69 0.12
70 0.15
71 0.18
72 0.21
73 0.27
74 0.32
75 0.37
76 0.4
77 0.44
78 0.49
79 0.51
80 0.53
81 0.49
82 0.47
83 0.49
84 0.48
85 0.48
86 0.44
87 0.44
88 0.41
89 0.4
90 0.39
91 0.31
92 0.29
93 0.24
94 0.21
95 0.16
96 0.13
97 0.12
98 0.13
99 0.12
100 0.17
101 0.18
102 0.19
103 0.2
104 0.21
105 0.2
106 0.18
107 0.18
108 0.12
109 0.12
110 0.1
111 0.09
112 0.09
113 0.08
114 0.06
115 0.06
116 0.07
117 0.06
118 0.06
119 0.06
120 0.06
121 0.08
122 0.1
123 0.11
124 0.11
125 0.11
126 0.1
127 0.1
128 0.11
129 0.11
130 0.11
131 0.14
132 0.15
133 0.16
134 0.17
135 0.19
136 0.18
137 0.2
138 0.26
139 0.3
140 0.37
141 0.43
142 0.45
143 0.48
144 0.49
145 0.5
146 0.47
147 0.44
148 0.39
149 0.37
150 0.38
151 0.37
152 0.35
153 0.32
154 0.29
155 0.24
156 0.21
157 0.21
158 0.19
159 0.19
160 0.2
161 0.23
162 0.21
163 0.22
164 0.23
165 0.2
166 0.26
167 0.32
168 0.36
169 0.36
170 0.36
171 0.37
172 0.4
173 0.39
174 0.33
175 0.29
176 0.3
177 0.33
178 0.33
179 0.32
180 0.28
181 0.29
182 0.29
183 0.31
184 0.34
185 0.37
186 0.45
187 0.52
188 0.61
189 0.69
190 0.75
191 0.8
192 0.82
193 0.82
194 0.86
195 0.89
196 0.86
197 0.88
198 0.87
199 0.86
200 0.87
201 0.88
202 0.88
203 0.88
204 0.85
205 0.81
206 0.78
207 0.72
208 0.68
209 0.68
210 0.67
211 0.66
212 0.71
213 0.74
214 0.7
215 0.74
216 0.74
217 0.74
218 0.72
219 0.68
220 0.6
221 0.54
222 0.54
223 0.46