Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EDA7

Protein Details
Accession A0A1Y2EDA7    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
246-265DMEKIAKINKHKRYFTRTEEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15, cyto_nucl 13, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR020471  AKR  
IPR018170  Aldo/ket_reductase_CS  
IPR023210  NADP_OxRdtase_dom  
IPR036812  NADP_OxRdtase_dom_sf  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF00248  Aldo_ket_red  
PROSITE View protein in PROSITE  
PS00798  ALDOKETO_REDUCTASE_1  
PS00062  ALDOKETO_REDUCTASE_2  
Amino Acid Sequences MATVAMNNGVKIPFVGIGTYLIEPKDAEVSVREALKMGYRLIDTANVYRNERAVGRGIKASGVKREEIFLSTKLWPSEYENPNAIKETLERLGLDYIDLLFLHQPSGNYIAGYKQLEKAYKEGIIKSIGISNFEGKYIEEILEKCEIKPQVIQVECHPYFVQEELRKVIDPENIKLMSWFPLGQGDKNLINEPVFKELGEKYHKTSAQIILKWHTQMGFLVIPGSKNVDHIRDNFNLFDFELTPEDMEKIAKINKHKRYFTRTEELLKQFAEFKPTYETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.09
4 0.11
5 0.13
6 0.13
7 0.13
8 0.12
9 0.12
10 0.12
11 0.12
12 0.14
13 0.12
14 0.12
15 0.12
16 0.15
17 0.18
18 0.19
19 0.18
20 0.15
21 0.16
22 0.2
23 0.2
24 0.17
25 0.16
26 0.16
27 0.17
28 0.17
29 0.2
30 0.18
31 0.2
32 0.26
33 0.26
34 0.28
35 0.29
36 0.28
37 0.27
38 0.25
39 0.23
40 0.24
41 0.24
42 0.24
43 0.26
44 0.25
45 0.26
46 0.29
47 0.3
48 0.3
49 0.3
50 0.3
51 0.27
52 0.29
53 0.27
54 0.25
55 0.25
56 0.19
57 0.2
58 0.2
59 0.22
60 0.21
61 0.21
62 0.2
63 0.23
64 0.32
65 0.32
66 0.33
67 0.34
68 0.35
69 0.35
70 0.36
71 0.29
72 0.2
73 0.18
74 0.18
75 0.16
76 0.15
77 0.14
78 0.14
79 0.15
80 0.14
81 0.12
82 0.09
83 0.07
84 0.07
85 0.06
86 0.05
87 0.05
88 0.06
89 0.06
90 0.07
91 0.07
92 0.08
93 0.12
94 0.11
95 0.1
96 0.11
97 0.11
98 0.13
99 0.14
100 0.14
101 0.15
102 0.17
103 0.2
104 0.21
105 0.22
106 0.2
107 0.23
108 0.23
109 0.2
110 0.19
111 0.18
112 0.17
113 0.15
114 0.17
115 0.13
116 0.13
117 0.13
118 0.14
119 0.13
120 0.13
121 0.13
122 0.09
123 0.1
124 0.09
125 0.09
126 0.08
127 0.08
128 0.1
129 0.14
130 0.14
131 0.13
132 0.17
133 0.16
134 0.16
135 0.17
136 0.17
137 0.19
138 0.2
139 0.21
140 0.19
141 0.28
142 0.27
143 0.28
144 0.25
145 0.19
146 0.19
147 0.19
148 0.24
149 0.17
150 0.18
151 0.19
152 0.2
153 0.19
154 0.2
155 0.21
156 0.19
157 0.19
158 0.19
159 0.22
160 0.21
161 0.21
162 0.21
163 0.19
164 0.16
165 0.15
166 0.14
167 0.09
168 0.15
169 0.16
170 0.17
171 0.17
172 0.17
173 0.18
174 0.19
175 0.2
176 0.15
177 0.14
178 0.16
179 0.16
180 0.18
181 0.16
182 0.15
183 0.16
184 0.16
185 0.22
186 0.26
187 0.26
188 0.26
189 0.33
190 0.34
191 0.34
192 0.37
193 0.39
194 0.4
195 0.41
196 0.4
197 0.37
198 0.38
199 0.37
200 0.34
201 0.26
202 0.19
203 0.17
204 0.18
205 0.14
206 0.12
207 0.13
208 0.12
209 0.12
210 0.12
211 0.15
212 0.11
213 0.15
214 0.17
215 0.2
216 0.23
217 0.26
218 0.31
219 0.32
220 0.34
221 0.31
222 0.3
223 0.27
224 0.23
225 0.21
226 0.16
227 0.15
228 0.15
229 0.14
230 0.14
231 0.13
232 0.14
233 0.13
234 0.12
235 0.1
236 0.13
237 0.17
238 0.21
239 0.31
240 0.4
241 0.5
242 0.59
243 0.67
244 0.71
245 0.76
246 0.8
247 0.79
248 0.78
249 0.73
250 0.71
251 0.72
252 0.67
253 0.61
254 0.53
255 0.46
256 0.42
257 0.38
258 0.38
259 0.29
260 0.27