Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2AL07

Protein Details
Accession A0A1Y2AL07    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
19-46LELLRIEKEKKEKKKLEKKNYLVKKINNHydrophilic
NLS Segment(s)
PositionSequence
9-42KKEKEKIKKDLELLRIEKEKKEKKKLEKKNYLVK
Subcellular Location(s) nucl 15, mito 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
Pfam View protein in Pfam  
PF13637  Ank_4  
PROSITE View protein in PROSITE  
PS50297  ANK_REP_REGION  
PS50088  ANK_REPEAT  
Amino Acid Sequences MRIELEEEKKEKEKIKKDLELLRIEKEKKEKKKLEKKNYLVKKINNKRDNNETLLTYECKYDNIEEVKKLIHYGMNINKKNKNGDTPLLIACKNGNIELVKYLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.66
3 0.68
4 0.7
5 0.73
6 0.71
7 0.7
8 0.63
9 0.59
10 0.57
11 0.52
12 0.5
13 0.52
14 0.55
15 0.57
16 0.65
17 0.68
18 0.72
19 0.81
20 0.88
21 0.89
22 0.9
23 0.88
24 0.87
25 0.87
26 0.86
27 0.82
28 0.77
29 0.77
30 0.77
31 0.79
32 0.77
33 0.72
34 0.67
35 0.68
36 0.65
37 0.57
38 0.48
39 0.38
40 0.31
41 0.29
42 0.26
43 0.18
44 0.16
45 0.12
46 0.12
47 0.12
48 0.11
49 0.14
50 0.17
51 0.19
52 0.18
53 0.19
54 0.19
55 0.18
56 0.18
57 0.15
58 0.11
59 0.1
60 0.17
61 0.25
62 0.34
63 0.39
64 0.44
65 0.48
66 0.5
67 0.56
68 0.52
69 0.51
70 0.46
71 0.45
72 0.44
73 0.43
74 0.43
75 0.4
76 0.36
77 0.3
78 0.25
79 0.24
80 0.21
81 0.18
82 0.18
83 0.16
84 0.18
85 0.19