Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2AD61

Protein Details
Accession A0A1Y2AD61    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-24TSEPKIKKFERPPLVKRNEPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito_nucl 12.332, cyto_nucl 12.166, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR026507  PIRC1/2  
Gene Ontology GO:0005879  C:axonemal microtubule  
GO:0035082  P:axoneme assembly  
Pfam View protein in Pfam  
PF14892  DUF4490  
Amino Acid Sequences MSDITSEPKIKKFERPPLVKRNEPMVLPEKFDRPEIWNYESKKQNMFYTTSSNDYGFYKPTKSEMPTSYYSVSHEFTKVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.7
3 0.73
4 0.77
5 0.82
6 0.77
7 0.7
8 0.66
9 0.59
10 0.5
11 0.46
12 0.42
13 0.35
14 0.33
15 0.32
16 0.28
17 0.27
18 0.27
19 0.24
20 0.21
21 0.25
22 0.26
23 0.28
24 0.3
25 0.32
26 0.38
27 0.42
28 0.39
29 0.38
30 0.36
31 0.34
32 0.31
33 0.31
34 0.26
35 0.26
36 0.27
37 0.27
38 0.26
39 0.24
40 0.23
41 0.22
42 0.21
43 0.18
44 0.18
45 0.17
46 0.16
47 0.19
48 0.23
49 0.24
50 0.3
51 0.3
52 0.33
53 0.35
54 0.38
55 0.37
56 0.33
57 0.32
58 0.3
59 0.29
60 0.26