Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZP32

Protein Details
Accession A0A1Y1ZP32    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
117-139NIKSHVRCLFRYRKKFSRKLFMKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR036156  Beta-gal/glucu_dom_sf  
IPR013783  Ig-like_fold  
Amino Acid Sequences MKKVFFIVKSSLWIVRYVNLVTYLYDYDGGIFRDAFLVSAPNVQIRDYTVRTNLDSSFTNANLEISMDIRNLSGGEKNSWSVIAKAYDEAGNNILKGASVKLDKLNIGKDKSVVSTNIKSHVRCLFRYRKKFSRKLFMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.24
4 0.21
5 0.19
6 0.18
7 0.17
8 0.15
9 0.17
10 0.15
11 0.13
12 0.13
13 0.11
14 0.1
15 0.12
16 0.12
17 0.11
18 0.1
19 0.09
20 0.1
21 0.1
22 0.09
23 0.07
24 0.07
25 0.07
26 0.09
27 0.09
28 0.1
29 0.11
30 0.11
31 0.11
32 0.12
33 0.17
34 0.16
35 0.18
36 0.19
37 0.2
38 0.21
39 0.23
40 0.21
41 0.18
42 0.17
43 0.18
44 0.17
45 0.15
46 0.15
47 0.13
48 0.13
49 0.1
50 0.09
51 0.07
52 0.06
53 0.06
54 0.06
55 0.06
56 0.05
57 0.06
58 0.05
59 0.06
60 0.08
61 0.08
62 0.09
63 0.1
64 0.11
65 0.11
66 0.11
67 0.11
68 0.09
69 0.1
70 0.1
71 0.1
72 0.1
73 0.11
74 0.11
75 0.11
76 0.11
77 0.11
78 0.1
79 0.1
80 0.1
81 0.09
82 0.07
83 0.08
84 0.07
85 0.09
86 0.09
87 0.11
88 0.13
89 0.15
90 0.17
91 0.18
92 0.25
93 0.28
94 0.29
95 0.29
96 0.28
97 0.28
98 0.29
99 0.29
100 0.26
101 0.26
102 0.29
103 0.31
104 0.37
105 0.4
106 0.38
107 0.4
108 0.45
109 0.43
110 0.41
111 0.48
112 0.52
113 0.58
114 0.68
115 0.72
116 0.75
117 0.81
118 0.87
119 0.87