Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2DHM9

Protein Details
Accession A0A1Y2DHM9    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
22-47AAELPPKKVKPPKRGPKVPKAPPSKFBasic
51-70QKAKKAAKKLNTPKIPPKGSHydrophilic
NLS Segment(s)
PositionSequence
27-68PKKVKPPKRGPKVPKAPPSKFILEQKAKKAAKKLNTPKIPPK
Subcellular Location(s) extr 8, cyto 6, plas 3, E.R. 3, vacu 3, mito 2
Family & Domain DBs
Amino Acid Sequences MNAKTFLLAILAFFLLISVVSAAELPPKKVKPPKRGPKVPKAPPSKFILEQKAKKAAKKLNTPKIPPKGSDEIPKTRDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.04
5 0.03
6 0.03
7 0.03
8 0.04
9 0.04
10 0.1
11 0.11
12 0.13
13 0.19
14 0.2
15 0.27
16 0.36
17 0.45
18 0.5
19 0.61
20 0.69
21 0.74
22 0.83
23 0.84
24 0.86
25 0.87
26 0.85
27 0.83
28 0.81
29 0.73
30 0.66
31 0.64
32 0.57
33 0.51
34 0.48
35 0.48
36 0.48
37 0.5
38 0.51
39 0.56
40 0.55
41 0.53
42 0.56
43 0.54
44 0.53
45 0.6
46 0.66
47 0.66
48 0.72
49 0.76
50 0.78
51 0.81
52 0.76
53 0.67
54 0.64
55 0.61
56 0.57
57 0.6
58 0.57
59 0.56
60 0.55