Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2C5X1

Protein Details
Accession A0A1Y2C5X1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-30AIKIKNETKMKKEKERKMMTIHydrophilic
NLS Segment(s)
PositionSequence
12-26KIKNETKMKKEKERK
Subcellular Location(s) mito_nucl 14, nucl 13.5, mito 13.5
Family & Domain DBs
Amino Acid Sequences MKLGKSSKVAIKIKNETKMKKEKERKMMTIGKPVRLNIKFNDIRNMNGKVYQLGLRIGSKNTTTMKKLKQAFKSLKFEESIKLKISNISTNM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.7
3 0.66
4 0.69
5 0.73
6 0.73
7 0.74
8 0.77
9 0.77
10 0.8
11 0.82
12 0.77
13 0.75
14 0.76
15 0.69
16 0.69
17 0.63
18 0.57
19 0.51
20 0.49
21 0.49
22 0.41
23 0.41
24 0.31
25 0.38
26 0.36
27 0.35
28 0.41
29 0.33
30 0.33
31 0.34
32 0.36
33 0.27
34 0.24
35 0.24
36 0.17
37 0.18
38 0.17
39 0.14
40 0.11
41 0.12
42 0.12
43 0.13
44 0.14
45 0.14
46 0.13
47 0.16
48 0.19
49 0.22
50 0.24
51 0.3
52 0.35
53 0.41
54 0.49
55 0.53
56 0.56
57 0.62
58 0.68
59 0.7
60 0.73
61 0.68
62 0.63
63 0.57
64 0.52
65 0.48
66 0.44
67 0.39
68 0.33
69 0.33
70 0.3
71 0.33
72 0.35