Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZFZ5

Protein Details
Accession A0A1Y1ZFZ5   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
37-61QPTIEKAKKKGKQDKNKKIKEKEGEBasic
NLS Segment(s)
PositionSequence
42-59KAKKKGKQDKNKKIKEKE
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MGCPPTRQLERAAMEVEVSPRSNTEALTELHPSVIAQPTIEKAKKKGKQDKNKKIKEKEGESKINVDEEEKNMASTRENHIKLLGGGSYYDVSEDLRSLKAYFSCPIIRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.24
4 0.18
5 0.16
6 0.14
7 0.13
8 0.16
9 0.15
10 0.14
11 0.14
12 0.15
13 0.15
14 0.17
15 0.18
16 0.16
17 0.15
18 0.15
19 0.13
20 0.12
21 0.13
22 0.11
23 0.09
24 0.1
25 0.12
26 0.19
27 0.22
28 0.21
29 0.24
30 0.34
31 0.4
32 0.49
33 0.58
34 0.62
35 0.7
36 0.8
37 0.85
38 0.86
39 0.9
40 0.9
41 0.85
42 0.83
43 0.79
44 0.76
45 0.73
46 0.7
47 0.66
48 0.57
49 0.54
50 0.46
51 0.39
52 0.31
53 0.24
54 0.18
55 0.15
56 0.17
57 0.15
58 0.15
59 0.14
60 0.15
61 0.14
62 0.16
63 0.21
64 0.26
65 0.27
66 0.27
67 0.28
68 0.28
69 0.27
70 0.25
71 0.19
72 0.1
73 0.09
74 0.1
75 0.1
76 0.09
77 0.09
78 0.08
79 0.08
80 0.08
81 0.09
82 0.09
83 0.1
84 0.12
85 0.12
86 0.15
87 0.16
88 0.19
89 0.2
90 0.23