Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2ACF9

Protein Details
Accession A0A1Y2ACF9   
Localization Confidence High
Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
35-59DLEPLDKRKLRKNKEKNFKFNIKRNBasic
70-99NDKIDNEKTKNYRKRKRKNYQLNEERKIKDBasic
NLS Segment(s)
PositionSequence
41-88KRKLRKNKEKNFKFNIKRNNKIFDKLVNKNDKIDNEKTKNYRKRKRKN
Subcellular Location(s) nucl 24, cyto_nucl 13.833
Family & Domain DBs
Amino Acid Sequences MKMNEKSNLENNKIYDNNKMNDYNSENESEDSFSDLEPLDKRKLRKNKEKNFKFNIKRNNKIFDKLVNKNDKIDNEKTKNYRKRKRKNYQLNEERKIKDRVSTSNKPFFERKTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.45
4 0.43
5 0.43
6 0.44
7 0.37
8 0.39
9 0.41
10 0.35
11 0.3
12 0.31
13 0.27
14 0.25
15 0.25
16 0.2
17 0.17
18 0.15
19 0.13
20 0.1
21 0.1
22 0.09
23 0.1
24 0.12
25 0.15
26 0.19
27 0.23
28 0.26
29 0.34
30 0.44
31 0.52
32 0.61
33 0.69
34 0.73
35 0.81
36 0.88
37 0.87
38 0.85
39 0.86
40 0.83
41 0.79
42 0.79
43 0.77
44 0.75
45 0.7
46 0.7
47 0.62
48 0.57
49 0.52
50 0.49
51 0.48
52 0.46
53 0.51
54 0.5
55 0.49
56 0.49
57 0.5
58 0.46
59 0.44
60 0.45
61 0.46
62 0.44
63 0.51
64 0.54
65 0.61
66 0.67
67 0.72
68 0.76
69 0.77
70 0.83
71 0.87
72 0.91
73 0.92
74 0.94
75 0.94
76 0.95
77 0.95
78 0.94
79 0.9
80 0.87
81 0.8
82 0.74
83 0.69
84 0.59
85 0.54
86 0.49
87 0.51
88 0.52
89 0.58
90 0.61
91 0.65
92 0.65
93 0.64
94 0.65