Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2CGM7

Protein Details
Accession A0A1Y2CGM7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
28-51KNKMQINKILYRKKKKCHFIYKFLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 7, E.R. 6, golg 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVIVRLKYLIIKLYSFLFLFLFFIFYFKNKMQINKILYRKKKKCHFIYKFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.17
4 0.12
5 0.1
6 0.11
7 0.09
8 0.09
9 0.07
10 0.08
11 0.07
12 0.08
13 0.11
14 0.11
15 0.18
16 0.18
17 0.22
18 0.26
19 0.33
20 0.38
21 0.43
22 0.52
23 0.55
24 0.64
25 0.71
26 0.75
27 0.78
28 0.83
29 0.85
30 0.86
31 0.88