Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CVZ4

Protein Details
Accession A0A1Y2CVZ4   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
195-228LDPLKHKVRNTMKKTTLKPKKKVRSKGIIKSAPSHydrophilic
NLS Segment(s)
PositionSequence
190-228QRSKTLDPLKHKVRNTMKKTTLKPKKKVRSKGIIKSAPS
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MSLESNSKSNAKKVSNASISNSIGRSNVNHNLKIKRNSSGILSKSRSNHEIEKDRKSSSNNNINHTEKKLNINEKKSKPDIENKKNKEIVDMKDFIPISYIPEGEEEEEEEEDLYYINSKKHENEEYIEIRYEEENFNDHNQECNEEEQESENEILNENDEEYVINTLQEDEEMKNIQNMIENLKKRISQRSKTLDPLKHKVRNTMKKTTLKPKKKVRSKGIIKSAPSYTKPTEASRLKTKNKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.56
4 0.55
5 0.53
6 0.52
7 0.48
8 0.43
9 0.34
10 0.27
11 0.26
12 0.24
13 0.24
14 0.31
15 0.33
16 0.37
17 0.43
18 0.5
19 0.57
20 0.62
21 0.59
22 0.55
23 0.52
24 0.48
25 0.48
26 0.48
27 0.44
28 0.45
29 0.45
30 0.44
31 0.46
32 0.49
33 0.46
34 0.43
35 0.45
36 0.45
37 0.52
38 0.53
39 0.57
40 0.56
41 0.56
42 0.55
43 0.53
44 0.53
45 0.53
46 0.57
47 0.52
48 0.54
49 0.58
50 0.58
51 0.58
52 0.53
53 0.47
54 0.41
55 0.44
56 0.46
57 0.49
58 0.52
59 0.57
60 0.63
61 0.64
62 0.68
63 0.65
64 0.62
65 0.57
66 0.6
67 0.62
68 0.63
69 0.68
70 0.66
71 0.71
72 0.7
73 0.65
74 0.62
75 0.57
76 0.51
77 0.47
78 0.43
79 0.35
80 0.36
81 0.36
82 0.28
83 0.24
84 0.19
85 0.16
86 0.14
87 0.14
88 0.09
89 0.1
90 0.11
91 0.1
92 0.1
93 0.07
94 0.07
95 0.07
96 0.07
97 0.06
98 0.06
99 0.05
100 0.05
101 0.04
102 0.05
103 0.06
104 0.07
105 0.09
106 0.1
107 0.12
108 0.16
109 0.19
110 0.19
111 0.2
112 0.24
113 0.25
114 0.25
115 0.24
116 0.19
117 0.18
118 0.16
119 0.16
120 0.11
121 0.1
122 0.1
123 0.11
124 0.12
125 0.13
126 0.13
127 0.14
128 0.14
129 0.15
130 0.15
131 0.16
132 0.15
133 0.13
134 0.13
135 0.13
136 0.13
137 0.13
138 0.12
139 0.11
140 0.1
141 0.11
142 0.1
143 0.09
144 0.08
145 0.07
146 0.06
147 0.06
148 0.06
149 0.06
150 0.07
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.06
157 0.08
158 0.07
159 0.09
160 0.1
161 0.1
162 0.11
163 0.11
164 0.11
165 0.13
166 0.13
167 0.17
168 0.24
169 0.25
170 0.27
171 0.3
172 0.33
173 0.33
174 0.43
175 0.47
176 0.47
177 0.55
178 0.61
179 0.64
180 0.69
181 0.75
182 0.71
183 0.7
184 0.72
185 0.72
186 0.71
187 0.68
188 0.69
189 0.71
190 0.74
191 0.73
192 0.74
193 0.73
194 0.75
195 0.81
196 0.82
197 0.82
198 0.82
199 0.85
200 0.85
201 0.87
202 0.89
203 0.91
204 0.9
205 0.9
206 0.9
207 0.9
208 0.9
209 0.86
210 0.79
211 0.73
212 0.7
213 0.65
214 0.58
215 0.55
216 0.47
217 0.47
218 0.47
219 0.46
220 0.5
221 0.5
222 0.54
223 0.58
224 0.64