Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BEP6

Protein Details
Accession A0A1Y2BEP6   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MYRNSQSQPRNNNNNNNKLDNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034964  LS  
IPR002180  LS/RS  
IPR036467  LS/RS_sf  
Gene Ontology GO:0009349  C:riboflavin synthase complex  
GO:0000906  F:6,7-dimethyl-8-ribityllumazine synthase activity  
GO:0009231  P:riboflavin biosynthetic process  
Pfam View protein in Pfam  
PF00885  DMRL_synthase  
Amino Acid Sequences MYRNSQSQPRNNNNNNNKLDNFDRYENNYRILIVQSAWNYDSSDALAKDVYLTLKNQYHIKESNICIYQITQAIDLPYTAQHLINAAKNKGQPFDVVICIGVIVSRYEQMVNTVNQYLMKITLETGTPIINGILSGKTNGNMELFYDNGKRYDLINLGCYWAKVAMEMAGIHST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.82
3 0.77
4 0.68
5 0.62
6 0.58
7 0.53
8 0.49
9 0.43
10 0.42
11 0.43
12 0.51
13 0.47
14 0.46
15 0.4
16 0.35
17 0.32
18 0.29
19 0.23
20 0.15
21 0.17
22 0.15
23 0.17
24 0.17
25 0.16
26 0.15
27 0.15
28 0.14
29 0.11
30 0.13
31 0.11
32 0.11
33 0.1
34 0.09
35 0.1
36 0.1
37 0.1
38 0.09
39 0.09
40 0.14
41 0.17
42 0.19
43 0.22
44 0.23
45 0.26
46 0.27
47 0.3
48 0.31
49 0.29
50 0.33
51 0.31
52 0.29
53 0.25
54 0.23
55 0.22
56 0.18
57 0.17
58 0.11
59 0.11
60 0.11
61 0.1
62 0.1
63 0.08
64 0.06
65 0.07
66 0.07
67 0.06
68 0.06
69 0.07
70 0.09
71 0.12
72 0.15
73 0.14
74 0.16
75 0.18
76 0.19
77 0.18
78 0.17
79 0.14
80 0.14
81 0.15
82 0.13
83 0.11
84 0.1
85 0.09
86 0.08
87 0.08
88 0.06
89 0.04
90 0.04
91 0.04
92 0.05
93 0.05
94 0.06
95 0.06
96 0.08
97 0.11
98 0.11
99 0.12
100 0.13
101 0.13
102 0.13
103 0.13
104 0.11
105 0.09
106 0.09
107 0.07
108 0.07
109 0.08
110 0.08
111 0.08
112 0.09
113 0.08
114 0.07
115 0.08
116 0.07
117 0.06
118 0.06
119 0.06
120 0.07
121 0.07
122 0.09
123 0.09
124 0.1
125 0.11
126 0.12
127 0.11
128 0.1
129 0.12
130 0.11
131 0.11
132 0.13
133 0.15
134 0.16
135 0.16
136 0.17
137 0.16
138 0.16
139 0.2
140 0.22
141 0.21
142 0.23
143 0.22
144 0.25
145 0.25
146 0.24
147 0.2
148 0.17
149 0.15
150 0.12
151 0.13
152 0.1
153 0.11
154 0.11