Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2AN85

Protein Details
Accession A0A1Y2AN85    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAKSKNHTNHNQIRKQHRNGIHydrophilic
NLS Segment(s)
PositionSequence
22-24KRA
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQIRKQHRNGIKRAPHNKYPSLRGVDPKFLRNQRFAKKGSFLARKNAAAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.79
4 0.78
5 0.76
6 0.75
7 0.77
8 0.74
9 0.74
10 0.77
11 0.74
12 0.72
13 0.7
14 0.7
15 0.63
16 0.59
17 0.54
18 0.49
19 0.45
20 0.44
21 0.41
22 0.43
23 0.41
24 0.4
25 0.43
26 0.45
27 0.47
28 0.48
29 0.54
30 0.54
31 0.59
32 0.58
33 0.56
34 0.53
35 0.57
36 0.59
37 0.6
38 0.54
39 0.56
40 0.6