Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2F1Y6

Protein Details
Accession A0A1Y2F1Y6   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-50VSGVNIKKKRQYRQYMNRRGGFNHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, cyto_nucl 11, nucl 9, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0016020  C:membrane  
GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences DIEAQMKAIMGFGGFDSTKGKHVPGTDVSGVNIKKKRQYRQYMNRRGGFNRYGIFFFFVYYMKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.11
4 0.12
5 0.14
6 0.15
7 0.15
8 0.14
9 0.16
10 0.19
11 0.19
12 0.23
13 0.22
14 0.21
15 0.21
16 0.23
17 0.23
18 0.25
19 0.26
20 0.23
21 0.28
22 0.35
23 0.43
24 0.48
25 0.58
26 0.64
27 0.71
28 0.81
29 0.84
30 0.86
31 0.84
32 0.78
33 0.7
34 0.65
35 0.57
36 0.5
37 0.42
38 0.36
39 0.31
40 0.29
41 0.28
42 0.22
43 0.2
44 0.17