Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2AF12

Protein Details
Accession A0A1Y2AF12   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-22VILKKNQKTKTTKKAEPTEEAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, cyto_nucl 9, cyto 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002883  CBM10/Dockerin_dom  
IPR009034  Dockerin_dom_fun_sf  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF02013  CBM_10  
PROSITE View protein in PROSITE  
PS51763  CBM10  
Amino Acid Sequences MVILKKNQKTKTTKKAEPTEEATSCWAKKLGYDCCTGCNSVYSDESGEWGFENDKWCGIVENCKSETSTCTGYPDFPCCKGCDVAFSDTTGDWGVENNEWCGIKSTCKGSSAAPDTCFSEPDYPCCTSCNVVETDGNQRYRII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.8
4 0.77
5 0.72
6 0.69
7 0.6
8 0.54
9 0.48
10 0.43
11 0.36
12 0.32
13 0.27
14 0.19
15 0.21
16 0.27
17 0.31
18 0.3
19 0.34
20 0.33
21 0.35
22 0.37
23 0.34
24 0.27
25 0.22
26 0.2
27 0.17
28 0.18
29 0.15
30 0.14
31 0.13
32 0.14
33 0.12
34 0.1
35 0.08
36 0.08
37 0.08
38 0.09
39 0.11
40 0.1
41 0.1
42 0.11
43 0.1
44 0.11
45 0.11
46 0.17
47 0.17
48 0.21
49 0.22
50 0.22
51 0.23
52 0.22
53 0.22
54 0.18
55 0.18
56 0.14
57 0.15
58 0.15
59 0.17
60 0.18
61 0.21
62 0.2
63 0.2
64 0.21
65 0.19
66 0.21
67 0.2
68 0.19
69 0.17
70 0.19
71 0.19
72 0.19
73 0.18
74 0.17
75 0.15
76 0.16
77 0.13
78 0.09
79 0.06
80 0.07
81 0.07
82 0.08
83 0.09
84 0.09
85 0.11
86 0.11
87 0.11
88 0.15
89 0.14
90 0.16
91 0.19
92 0.23
93 0.23
94 0.25
95 0.25
96 0.23
97 0.3
98 0.33
99 0.33
100 0.3
101 0.3
102 0.31
103 0.31
104 0.3
105 0.25
106 0.26
107 0.24
108 0.27
109 0.3
110 0.29
111 0.29
112 0.29
113 0.29
114 0.24
115 0.25
116 0.24
117 0.21
118 0.22
119 0.23
120 0.24
121 0.32
122 0.36
123 0.36