Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2ASR3

Protein Details
Accession A0A1Y2ASR3   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
92-111NNNNKNSQNKENKENKENKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.333, cyto 5, cyto_pero 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR002068  A-crystallin/Hsp20_dom  
IPR008978  HSP20-like_chaperone  
Pfam View protein in Pfam  
PF00011  HSP20  
PROSITE View protein in PROSITE  
PS01031  SHSP  
CDD cd06464  ACD_sHsps-like  
Amino Acid Sequences MKIYSCSLRKQINNSDISSELKYNPGMNFNEDGENFYIHADLPGMTRDQIKIEFNEEDHSLIISGERKSPYETNQNEILSEQTSNNENTNENNNNKNSQNKENKENKENKDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.53
3 0.46
4 0.44
5 0.39
6 0.31
7 0.23
8 0.22
9 0.21
10 0.21
11 0.2
12 0.23
13 0.22
14 0.23
15 0.24
16 0.23
17 0.25
18 0.22
19 0.23
20 0.19
21 0.18
22 0.15
23 0.13
24 0.12
25 0.08
26 0.08
27 0.06
28 0.05
29 0.06
30 0.06
31 0.07
32 0.07
33 0.08
34 0.08
35 0.09
36 0.11
37 0.12
38 0.12
39 0.14
40 0.14
41 0.13
42 0.15
43 0.14
44 0.12
45 0.11
46 0.1
47 0.07
48 0.07
49 0.07
50 0.08
51 0.09
52 0.11
53 0.12
54 0.13
55 0.16
56 0.18
57 0.22
58 0.29
59 0.3
60 0.31
61 0.35
62 0.34
63 0.31
64 0.3
65 0.27
66 0.18
67 0.17
68 0.14
69 0.11
70 0.13
71 0.14
72 0.15
73 0.16
74 0.15
75 0.17
76 0.24
77 0.3
78 0.31
79 0.37
80 0.38
81 0.41
82 0.45
83 0.5
84 0.49
85 0.52
86 0.59
87 0.59
88 0.66
89 0.71
90 0.76
91 0.78
92 0.81