Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2DIJ9

Protein Details
Accession A0A1Y2DIJ9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
77-103NTTTPVNENKPPKKKRKKRNINNNYKLHydrophilic
NLS Segment(s)
PositionSequence
86-95KPPKKKRKKR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSANEQNSNIIKDKSEQKANIKDEKMTINSLINTNTTATATATASATNNNAGTSNSISESIKKGSVNVDTKNKEDNNTTTPVNENKPPKKKRKKRNINNNYKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.43
3 0.45
4 0.49
5 0.58
6 0.62
7 0.65
8 0.59
9 0.53
10 0.48
11 0.47
12 0.41
13 0.34
14 0.3
15 0.24
16 0.23
17 0.23
18 0.21
19 0.17
20 0.15
21 0.14
22 0.12
23 0.1
24 0.09
25 0.08
26 0.08
27 0.08
28 0.08
29 0.07
30 0.07
31 0.07
32 0.07
33 0.08
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.08
40 0.08
41 0.08
42 0.08
43 0.09
44 0.09
45 0.1
46 0.12
47 0.12
48 0.13
49 0.13
50 0.13
51 0.14
52 0.21
53 0.24
54 0.27
55 0.34
56 0.35
57 0.37
58 0.43
59 0.41
60 0.37
61 0.37
62 0.36
63 0.31
64 0.32
65 0.31
66 0.26
67 0.29
68 0.31
69 0.31
70 0.34
71 0.4
72 0.47
73 0.57
74 0.66
75 0.73
76 0.8
77 0.86
78 0.9
79 0.92
80 0.94
81 0.94
82 0.96
83 0.96