Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2ES70

Protein Details
Accession A0A1Y2ES70   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MLFAPKCKKCQKPIKGETVCAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001781  Znf_LIM  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00412  LIM  
PROSITE View protein in PROSITE  
PS00478  LIM_DOMAIN_1  
PS50023  LIM_DOMAIN_2  
CDD cd08368  LIM  
Amino Acid Sequences MLFAPKCKKCQKPIKGETVCALGSKYHKACFSCITCNKPFPDKSFYVFNNNPVCRRHYHQLNNSLCTKCDEPIEGPCAEVIEGRFHPNCFVCSVCQTPLTGLYYNYQGEAYCEEDIMRIHKERINKANKRRTIMSYIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.82
3 0.76
4 0.68
5 0.6
6 0.5
7 0.4
8 0.31
9 0.23
10 0.22
11 0.27
12 0.27
13 0.27
14 0.3
15 0.31
16 0.33
17 0.37
18 0.38
19 0.4
20 0.43
21 0.46
22 0.46
23 0.5
24 0.5
25 0.5
26 0.5
27 0.44
28 0.46
29 0.41
30 0.4
31 0.42
32 0.4
33 0.42
34 0.4
35 0.42
36 0.44
37 0.43
38 0.44
39 0.39
40 0.4
41 0.35
42 0.39
43 0.4
44 0.41
45 0.48
46 0.51
47 0.59
48 0.6
49 0.59
50 0.58
51 0.51
52 0.42
53 0.36
54 0.3
55 0.21
56 0.18
57 0.17
58 0.13
59 0.15
60 0.17
61 0.14
62 0.14
63 0.12
64 0.12
65 0.1
66 0.1
67 0.08
68 0.09
69 0.1
70 0.13
71 0.14
72 0.14
73 0.16
74 0.17
75 0.17
76 0.15
77 0.15
78 0.13
79 0.16
80 0.18
81 0.17
82 0.17
83 0.16
84 0.16
85 0.17
86 0.19
87 0.16
88 0.15
89 0.15
90 0.17
91 0.17
92 0.17
93 0.15
94 0.12
95 0.12
96 0.13
97 0.14
98 0.12
99 0.12
100 0.11
101 0.12
102 0.13
103 0.15
104 0.17
105 0.16
106 0.19
107 0.22
108 0.29
109 0.37
110 0.46
111 0.54
112 0.6
113 0.68
114 0.76
115 0.8
116 0.8
117 0.77
118 0.73