Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2C447

Protein Details
Accession A0A1Y2C447    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
63-100DIENEYRKSKYKKNKNKSNMKSKRNKEKDSNNNENKMKHydrophilic
NLS Segment(s)
PositionSequence
69-90RKSKYKKNKNKSNMKSKRNKEK
Subcellular Location(s) nucl 15, cyto_nucl 10, mito 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MPHKKVIGVLIDGWYYIRDTNKNLILSDKTKENNIKNINLFLDILRNKINSHNYIDKNIDENDIENEYRKSKYKKNKNKSNMKSKRNKEKDSNNNENKMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.12
4 0.14
5 0.15
6 0.18
7 0.24
8 0.29
9 0.3
10 0.29
11 0.31
12 0.31
13 0.32
14 0.31
15 0.3
16 0.26
17 0.31
18 0.37
19 0.36
20 0.41
21 0.42
22 0.44
23 0.4
24 0.41
25 0.36
26 0.3
27 0.27
28 0.18
29 0.2
30 0.16
31 0.16
32 0.15
33 0.15
34 0.15
35 0.19
36 0.23
37 0.19
38 0.23
39 0.29
40 0.29
41 0.32
42 0.33
43 0.29
44 0.28
45 0.26
46 0.23
47 0.15
48 0.15
49 0.14
50 0.15
51 0.14
52 0.13
53 0.14
54 0.15
55 0.17
56 0.23
57 0.27
58 0.34
59 0.45
60 0.54
61 0.64
62 0.73
63 0.82
64 0.86
65 0.91
66 0.93
67 0.93
68 0.92
69 0.92
70 0.91
71 0.91
72 0.92
73 0.9
74 0.89
75 0.88
76 0.88
77 0.89
78 0.88
79 0.89
80 0.87