Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2AC28

Protein Details
Accession A0A1Y2AC28    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
123-163ELEEEKKEKKKIRKHLKLLRIEKEKKENKKLEKKNYKTLLTBasic
NLS Segment(s)
PositionSequence
113-156IRKDLKLLRIELEEEKKEKKKIRKHLKLLRIEKEKKENKKLEKK
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
Pfam View protein in Pfam  
PF13637  Ank_4  
Amino Acid Sequences MFKMLVKYSIEKGIKLIIDENDIAEMISEEYYLCELNNISEINSKFIELIYFCNNKNIIEVIFSVNSYFWKKFREFNENKGIENERKKYEVLEIENEIKKIELEEERKENEKIRKDLKLLRIELEEEKKEKKKIRKHLKLLRIEKEKKENKKLEKKNYKTLLTSVFKQKLINYGMDINKKNKGDTSLLNACKNRNIELAKYLLSDKKLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.28
4 0.2
5 0.23
6 0.23
7 0.22
8 0.17
9 0.16
10 0.14
11 0.11
12 0.1
13 0.07
14 0.06
15 0.06
16 0.05
17 0.06
18 0.07
19 0.07
20 0.06
21 0.07
22 0.07
23 0.07
24 0.1
25 0.1
26 0.1
27 0.16
28 0.17
29 0.19
30 0.19
31 0.18
32 0.16
33 0.16
34 0.16
35 0.11
36 0.14
37 0.17
38 0.2
39 0.2
40 0.25
41 0.25
42 0.24
43 0.24
44 0.22
45 0.16
46 0.14
47 0.15
48 0.13
49 0.13
50 0.12
51 0.11
52 0.1
53 0.12
54 0.15
55 0.15
56 0.14
57 0.19
58 0.21
59 0.26
60 0.31
61 0.4
62 0.4
63 0.45
64 0.54
65 0.51
66 0.49
67 0.47
68 0.46
69 0.41
70 0.45
71 0.42
72 0.33
73 0.34
74 0.33
75 0.31
76 0.31
77 0.29
78 0.25
79 0.23
80 0.23
81 0.26
82 0.27
83 0.26
84 0.22
85 0.17
86 0.15
87 0.12
88 0.12
89 0.12
90 0.14
91 0.17
92 0.21
93 0.22
94 0.25
95 0.26
96 0.29
97 0.31
98 0.34
99 0.36
100 0.38
101 0.4
102 0.41
103 0.47
104 0.49
105 0.49
106 0.44
107 0.4
108 0.37
109 0.35
110 0.35
111 0.34
112 0.28
113 0.23
114 0.28
115 0.31
116 0.36
117 0.42
118 0.47
119 0.52
120 0.61
121 0.7
122 0.75
123 0.81
124 0.84
125 0.86
126 0.88
127 0.86
128 0.85
129 0.83
130 0.79
131 0.75
132 0.76
133 0.75
134 0.74
135 0.76
136 0.76
137 0.76
138 0.81
139 0.84
140 0.85
141 0.88
142 0.85
143 0.85
144 0.84
145 0.77
146 0.69
147 0.62
148 0.6
149 0.54
150 0.52
151 0.51
152 0.48
153 0.45
154 0.44
155 0.42
156 0.39
157 0.38
158 0.34
159 0.27
160 0.29
161 0.34
162 0.4
163 0.43
164 0.39
165 0.44
166 0.43
167 0.42
168 0.39
169 0.38
170 0.35
171 0.34
172 0.39
173 0.42
174 0.46
175 0.51
176 0.5
177 0.48
178 0.5
179 0.48
180 0.42
181 0.4
182 0.39
183 0.35
184 0.37
185 0.38
186 0.33
187 0.32
188 0.34
189 0.31