Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H0ETW5

Protein Details
Accession H0ETW5    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
73-108LRGGAKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKVBasic
NLS Segment(s)
PositionSequence
73-99LRGGAKKRKKKVYTTPKKIKHKRKKTK
Subcellular Location(s) nucl 17, cyto_nucl 15, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002906  Ribosomal_S27a  
IPR011332  Ribosomal_zn-bd  
IPR038582  S27a-like_sf  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
IPR019954  Ubiquitin_CS  
IPR019956  Ubiquitin_dom  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01599  Ribosomal_S27  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS00299  UBIQUITIN_1  
PS50053  UBIQUITIN_2  
CDD cd01803  Ubl_ubiquitin  
Amino Acid Sequences MQIFVKTLTGKTITLECEGSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKVDGDGKIERLRRECPTPDCGAGVFMAAMHDRQYCGRCHLTYIFDEAGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.18
4 0.18
5 0.18
6 0.18
7 0.15
8 0.14
9 0.14
10 0.18
11 0.18
12 0.17
13 0.19
14 0.21
15 0.24
16 0.28
17 0.3
18 0.31
19 0.33
20 0.41
21 0.45
22 0.45
23 0.43
24 0.43
25 0.42
26 0.4
27 0.39
28 0.3
29 0.26
30 0.27
31 0.25
32 0.23
33 0.23
34 0.18
35 0.22
36 0.22
37 0.2
38 0.18
39 0.17
40 0.16
41 0.14
42 0.14
43 0.11
44 0.17
45 0.19
46 0.2
47 0.22
48 0.2
49 0.19
50 0.19
51 0.21
52 0.17
53 0.15
54 0.13
55 0.14
56 0.16
57 0.16
58 0.16
59 0.15
60 0.13
61 0.15
62 0.21
63 0.27
64 0.35
65 0.44
66 0.52
67 0.61
68 0.64
69 0.7
70 0.75
71 0.77
72 0.79
73 0.8
74 0.83
75 0.83
76 0.89
77 0.91
78 0.91
79 0.91
80 0.91
81 0.92
82 0.92
83 0.94
84 0.92
85 0.93
86 0.91
87 0.89
88 0.88
89 0.83
90 0.77
91 0.68
92 0.6
93 0.49
94 0.42
95 0.35
96 0.26
97 0.25
98 0.23
99 0.25
100 0.29
101 0.32
102 0.33
103 0.35
104 0.38
105 0.36
106 0.4
107 0.42
108 0.41
109 0.43
110 0.43
111 0.41
112 0.38
113 0.33
114 0.28
115 0.22
116 0.17
117 0.11
118 0.08
119 0.08
120 0.07
121 0.07
122 0.08
123 0.09
124 0.1
125 0.14
126 0.17
127 0.19
128 0.24
129 0.3
130 0.29
131 0.33
132 0.35
133 0.35
134 0.34
135 0.38