Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZPV0

Protein Details
Accession A0A1Y1ZPV0    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
67-114NLISKYTNRKIKNKNNFKYKHKTHNNKYCYICEKKGHTTKECRYNKKRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 7, cyto 7, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MYNSLPLYAKFFIHPTKDYTSERFFNEINNIVTFKLYAGDSKLIEENLVQYFVHDRTQDNEDETSINLISKYTNRKIKNKNNFKYKHKTHNNKYCYICEKKGHTTKECRYNKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.34
4 0.39
5 0.41
6 0.42
7 0.43
8 0.42
9 0.42
10 0.4
11 0.35
12 0.32
13 0.33
14 0.31
15 0.26
16 0.24
17 0.22
18 0.19
19 0.19
20 0.17
21 0.12
22 0.1
23 0.08
24 0.08
25 0.09
26 0.11
27 0.11
28 0.13
29 0.13
30 0.12
31 0.12
32 0.11
33 0.11
34 0.09
35 0.1
36 0.08
37 0.07
38 0.09
39 0.1
40 0.12
41 0.11
42 0.11
43 0.13
44 0.15
45 0.16
46 0.15
47 0.14
48 0.13
49 0.13
50 0.12
51 0.11
52 0.08
53 0.08
54 0.06
55 0.06
56 0.07
57 0.11
58 0.17
59 0.24
60 0.32
61 0.37
62 0.47
63 0.57
64 0.67
65 0.74
66 0.78
67 0.8
68 0.83
69 0.85
70 0.85
71 0.85
72 0.83
73 0.83
74 0.83
75 0.85
76 0.85
77 0.87
78 0.85
79 0.82
80 0.78
81 0.74
82 0.72
83 0.68
84 0.64
85 0.61
86 0.61
87 0.64
88 0.68
89 0.68
90 0.68
91 0.71
92 0.74
93 0.77
94 0.81