Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZNZ0

Protein Details
Accession A0A1Y1ZNZ0   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
72-99KEEINKILECRKKKKKKNIQIKSIILHFHydrophilic
NLS Segment(s)
PositionSequence
82-88RKKKKKK
Subcellular Location(s) nucl 5.5, cyto_nucl 5, plas 4, pero 4, E.R. 4, cyto 3.5, mito 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
IPR039678  CTNNBL1  
IPR013180  CTNNBL1_N  
Gene Ontology GO:0016020  C:membrane  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08216  CTNNBL  
Amino Acid Sequences MFYLRRLDSGLLTYQLISHIIGHLCIFKEIPIKERIVMLLNRNKLKLKDVKAVIIDYRDNLGDTKDSDIIEKEEINKILECRKKKKKKNIQIKSIILHFFFFFFFIIIIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.11
5 0.09
6 0.1
7 0.1
8 0.1
9 0.11
10 0.12
11 0.12
12 0.12
13 0.12
14 0.11
15 0.17
16 0.17
17 0.21
18 0.21
19 0.22
20 0.22
21 0.23
22 0.22
23 0.2
24 0.22
25 0.24
26 0.28
27 0.32
28 0.33
29 0.35
30 0.36
31 0.33
32 0.37
33 0.37
34 0.36
35 0.38
36 0.37
37 0.38
38 0.36
39 0.36
40 0.31
41 0.25
42 0.2
43 0.13
44 0.13
45 0.1
46 0.09
47 0.09
48 0.08
49 0.07
50 0.08
51 0.1
52 0.11
53 0.11
54 0.11
55 0.12
56 0.13
57 0.13
58 0.13
59 0.13
60 0.15
61 0.15
62 0.16
63 0.17
64 0.17
65 0.24
66 0.3
67 0.36
68 0.43
69 0.53
70 0.62
71 0.72
72 0.82
73 0.85
74 0.89
75 0.93
76 0.93
77 0.93
78 0.92
79 0.87
80 0.8
81 0.75
82 0.67
83 0.56
84 0.47
85 0.37
86 0.28
87 0.22
88 0.18
89 0.13
90 0.1