Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZKV6

Protein Details
Accession A0A1Y1ZKV6   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
33-56RKDNSKVYKCTKYKKINKCKSFIIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 12.5, cyto 9, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007588  Znf_FLYWCH  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF04500  FLYWCH  
Amino Acid Sequences MEENLIIDISESNKGKEQIIINKKYKFNFSYIRKDNSKVYKCTKYKKINKCKSFIILNDKKEILKYDSSHNHPEQEYDVSLSIMKHKIKDGIEKSSIPFGIKIKPLYNKISKEMGLICPEYNSIKFQISRNLNKKKLSSNVTTFAEIPSESEYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.28
4 0.31
5 0.35
6 0.44
7 0.51
8 0.54
9 0.6
10 0.63
11 0.61
12 0.62
13 0.54
14 0.51
15 0.52
16 0.52
17 0.56
18 0.58
19 0.63
20 0.59
21 0.6
22 0.62
23 0.62
24 0.61
25 0.58
26 0.59
27 0.61
28 0.65
29 0.71
30 0.73
31 0.74
32 0.77
33 0.81
34 0.85
35 0.86
36 0.85
37 0.81
38 0.75
39 0.68
40 0.63
41 0.57
42 0.56
43 0.52
44 0.48
45 0.46
46 0.43
47 0.38
48 0.34
49 0.32
50 0.25
51 0.22
52 0.21
53 0.25
54 0.3
55 0.34
56 0.39
57 0.37
58 0.37
59 0.33
60 0.32
61 0.26
62 0.22
63 0.18
64 0.13
65 0.12
66 0.09
67 0.1
68 0.09
69 0.11
70 0.13
71 0.14
72 0.14
73 0.15
74 0.2
75 0.2
76 0.29
77 0.29
78 0.31
79 0.33
80 0.33
81 0.33
82 0.31
83 0.3
84 0.22
85 0.21
86 0.17
87 0.19
88 0.21
89 0.22
90 0.24
91 0.29
92 0.32
93 0.38
94 0.43
95 0.41
96 0.42
97 0.44
98 0.4
99 0.37
100 0.35
101 0.31
102 0.27
103 0.25
104 0.22
105 0.18
106 0.19
107 0.19
108 0.18
109 0.17
110 0.16
111 0.19
112 0.21
113 0.23
114 0.31
115 0.37
116 0.46
117 0.54
118 0.62
119 0.64
120 0.68
121 0.7
122 0.69
123 0.69
124 0.65
125 0.63
126 0.59
127 0.6
128 0.57
129 0.55
130 0.48
131 0.4
132 0.35
133 0.27
134 0.22