Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2AGJ5

Protein Details
Accession A0A1Y2AGJ5   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
178-197KHNSTNSVTGRKKTKRRKAGBasic
NLS Segment(s)
PositionSequence
187-197GRKKTKRRKAG
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR018482  Znf-C4H2  
Pfam View protein in Pfam  
PF10146  zf-C4H2  
Amino Acid Sequences MDNNDNSSTDYYLTKLNELEIINRKTEELIKIKSSIIEHSQKLEKGEAVYQEIISEKNKLIKEKDLLKRMLIEIQNDLDDLSKSEKELKKENEKTRDNLKNLREEYNPLKDTVDELRAKQLLSRLPNLQEEIDKEMTIYLEKRRNRWIEAGIGNNDISSEPSIPDSPYSTPSPSTRIKHNSTNSVTGRKKTKRRKAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.18
4 0.21
5 0.2
6 0.26
7 0.3
8 0.31
9 0.31
10 0.31
11 0.31
12 0.28
13 0.32
14 0.32
15 0.29
16 0.31
17 0.32
18 0.33
19 0.33
20 0.34
21 0.31
22 0.29
23 0.29
24 0.31
25 0.3
26 0.33
27 0.37
28 0.36
29 0.36
30 0.34
31 0.28
32 0.23
33 0.25
34 0.22
35 0.21
36 0.2
37 0.18
38 0.17
39 0.16
40 0.16
41 0.14
42 0.14
43 0.12
44 0.17
45 0.2
46 0.23
47 0.25
48 0.29
49 0.34
50 0.41
51 0.48
52 0.48
53 0.47
54 0.45
55 0.44
56 0.39
57 0.4
58 0.32
59 0.25
60 0.2
61 0.2
62 0.19
63 0.17
64 0.16
65 0.1
66 0.08
67 0.08
68 0.09
69 0.09
70 0.09
71 0.17
72 0.2
73 0.22
74 0.3
75 0.35
76 0.43
77 0.52
78 0.6
79 0.61
80 0.61
81 0.62
82 0.63
83 0.65
84 0.57
85 0.55
86 0.5
87 0.48
88 0.48
89 0.48
90 0.39
91 0.36
92 0.37
93 0.37
94 0.35
95 0.28
96 0.26
97 0.23
98 0.24
99 0.22
100 0.24
101 0.17
102 0.17
103 0.2
104 0.21
105 0.21
106 0.2
107 0.21
108 0.2
109 0.22
110 0.24
111 0.23
112 0.25
113 0.27
114 0.27
115 0.24
116 0.21
117 0.2
118 0.22
119 0.2
120 0.17
121 0.16
122 0.15
123 0.14
124 0.14
125 0.14
126 0.16
127 0.23
128 0.26
129 0.3
130 0.38
131 0.42
132 0.44
133 0.46
134 0.42
135 0.42
136 0.43
137 0.45
138 0.38
139 0.35
140 0.32
141 0.27
142 0.24
143 0.17
144 0.14
145 0.11
146 0.1
147 0.09
148 0.12
149 0.13
150 0.13
151 0.15
152 0.16
153 0.16
154 0.19
155 0.22
156 0.21
157 0.24
158 0.25
159 0.3
160 0.35
161 0.37
162 0.42
163 0.47
164 0.51
165 0.57
166 0.62
167 0.65
168 0.63
169 0.68
170 0.64
171 0.66
172 0.65
173 0.63
174 0.66
175 0.67
176 0.73
177 0.75