Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2FT99

Protein Details
Accession A0A1Y2FT99    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
91-111STAKNKFNTKIKKNVIQKYKIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 6, E.R. 5, golg 5, extr 4, pero 3, vacu 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIPYHNLVKFKLRFLNLFFLGLTAAFVFGKSINDKGNSKVDENFVKNVINAENIVKLHYESNISNEELGNLLEKGWDYAESYIINNNIENSTAKNKFNTKIKKNVIQKYKINGIQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.49
3 0.4
4 0.38
5 0.32
6 0.25
7 0.22
8 0.19
9 0.15
10 0.07
11 0.07
12 0.05
13 0.05
14 0.06
15 0.06
16 0.09
17 0.1
18 0.12
19 0.14
20 0.18
21 0.19
22 0.22
23 0.28
24 0.28
25 0.28
26 0.28
27 0.29
28 0.31
29 0.32
30 0.3
31 0.25
32 0.23
33 0.21
34 0.2
35 0.17
36 0.12
37 0.1
38 0.09
39 0.1
40 0.1
41 0.1
42 0.09
43 0.09
44 0.09
45 0.08
46 0.1
47 0.08
48 0.11
49 0.12
50 0.12
51 0.12
52 0.11
53 0.11
54 0.09
55 0.09
56 0.08
57 0.06
58 0.05
59 0.05
60 0.05
61 0.06
62 0.06
63 0.06
64 0.06
65 0.07
66 0.09
67 0.09
68 0.1
69 0.12
70 0.12
71 0.12
72 0.11
73 0.12
74 0.11
75 0.12
76 0.12
77 0.13
78 0.2
79 0.24
80 0.25
81 0.29
82 0.34
83 0.39
84 0.49
85 0.56
86 0.55
87 0.62
88 0.68
89 0.73
90 0.78
91 0.81
92 0.81
93 0.79
94 0.78
95 0.75
96 0.77