Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2AK56

Protein Details
Accession A0A1Y2AK56    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
111-142NENGMEIDKKTKKNKNKNKKKNKYRKDIKTFKBasic
NLS Segment(s)
PositionSequence
119-142KKTKKNKNKNKKKNKYRKDIKTFK
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR024721  Snurportin-1_N  
Pfam View protein in Pfam  
PF11538  Snurportin1  
Amino Acid Sequences MENFTFTFNLDNKENNTENNTSFRKKDYKATSFTKTREEKQEERRKKILEEQRQKRNSLVNQARKLIELSIRKENGEDDSDSDSDFEIPNQVVDTTTSSSASNNNMSIENNENGMEIDKKTKKNKNKNKKKNKYRKDIKTFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.35
4 0.33
5 0.33
6 0.37
7 0.39
8 0.37
9 0.37
10 0.41
11 0.43
12 0.43
13 0.5
14 0.52
15 0.54
16 0.57
17 0.61
18 0.63
19 0.62
20 0.61
21 0.61
22 0.56
23 0.55
24 0.58
25 0.6
26 0.6
27 0.64
28 0.73
29 0.73
30 0.75
31 0.76
32 0.68
33 0.63
34 0.65
35 0.64
36 0.64
37 0.65
38 0.67
39 0.71
40 0.72
41 0.71
42 0.63
43 0.6
44 0.52
45 0.52
46 0.53
47 0.51
48 0.51
49 0.53
50 0.51
51 0.44
52 0.41
53 0.32
54 0.28
55 0.23
56 0.23
57 0.27
58 0.27
59 0.27
60 0.26
61 0.26
62 0.22
63 0.2
64 0.16
65 0.12
66 0.14
67 0.15
68 0.14
69 0.14
70 0.12
71 0.1
72 0.1
73 0.08
74 0.06
75 0.06
76 0.06
77 0.07
78 0.06
79 0.06
80 0.07
81 0.09
82 0.09
83 0.1
84 0.11
85 0.11
86 0.11
87 0.13
88 0.15
89 0.15
90 0.14
91 0.14
92 0.14
93 0.15
94 0.17
95 0.2
96 0.17
97 0.17
98 0.16
99 0.15
100 0.14
101 0.15
102 0.14
103 0.11
104 0.2
105 0.26
106 0.33
107 0.42
108 0.52
109 0.61
110 0.7
111 0.81
112 0.83
113 0.88
114 0.93
115 0.95
116 0.96
117 0.97
118 0.97
119 0.97
120 0.97
121 0.96
122 0.96