Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1ZBZ7

Protein Details
Accession A0A1Y1ZBZ7    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
88-112EKDVQRFKRRQKKLITIIKKNKNIKHydrophilic
NLS Segment(s)
PositionSequence
96-100RRQKK
189-192KTKR
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MINELKEIFSETGPSRLFEIEMKIKKLEIENDDFKLYIDNLNSSCTEYNNKAKLQNKSKLSEEIKVLYSLEELNKVGIAYSFKFLYVEKDVQRFKRRQKKLITIIKKNKNIKTVEIKEVYQHEDQINRVRNGKLQYNFNKEINSNEYCQYYHKNGHNTDNCFFNPSNSPNNNYRGEKKNNNNKSINKIKTKRASLSRNGSKRNFKSYNVNYEEQNSSDSDSDPSFDFCFNITTNIVKDNFNRVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.22
4 0.23
5 0.2
6 0.25
7 0.28
8 0.33
9 0.35
10 0.34
11 0.34
12 0.36
13 0.38
14 0.38
15 0.34
16 0.37
17 0.39
18 0.4
19 0.41
20 0.38
21 0.34
22 0.29
23 0.24
24 0.19
25 0.16
26 0.17
27 0.16
28 0.18
29 0.19
30 0.19
31 0.19
32 0.18
33 0.21
34 0.24
35 0.32
36 0.35
37 0.37
38 0.42
39 0.48
40 0.56
41 0.6
42 0.63
43 0.6
44 0.59
45 0.6
46 0.61
47 0.58
48 0.52
49 0.46
50 0.4
51 0.36
52 0.32
53 0.29
54 0.2
55 0.18
56 0.15
57 0.13
58 0.12
59 0.11
60 0.1
61 0.1
62 0.1
63 0.09
64 0.08
65 0.1
66 0.09
67 0.11
68 0.11
69 0.1
70 0.11
71 0.11
72 0.14
73 0.17
74 0.2
75 0.22
76 0.28
77 0.32
78 0.39
79 0.47
80 0.5
81 0.55
82 0.61
83 0.65
84 0.67
85 0.72
86 0.75
87 0.77
88 0.8
89 0.79
90 0.79
91 0.82
92 0.83
93 0.82
94 0.8
95 0.74
96 0.7
97 0.62
98 0.57
99 0.57
100 0.52
101 0.5
102 0.45
103 0.41
104 0.37
105 0.37
106 0.35
107 0.25
108 0.23
109 0.18
110 0.17
111 0.18
112 0.23
113 0.27
114 0.24
115 0.26
116 0.25
117 0.28
118 0.3
119 0.35
120 0.31
121 0.34
122 0.4
123 0.45
124 0.48
125 0.45
126 0.44
127 0.37
128 0.37
129 0.33
130 0.29
131 0.22
132 0.21
133 0.21
134 0.2
135 0.22
136 0.23
137 0.22
138 0.26
139 0.3
140 0.35
141 0.37
142 0.46
143 0.5
144 0.5
145 0.47
146 0.45
147 0.4
148 0.37
149 0.34
150 0.27
151 0.26
152 0.25
153 0.33
154 0.31
155 0.36
156 0.36
157 0.41
158 0.45
159 0.43
160 0.46
161 0.46
162 0.52
163 0.57
164 0.63
165 0.69
166 0.72
167 0.76
168 0.77
169 0.73
170 0.74
171 0.74
172 0.72
173 0.72
174 0.69
175 0.71
176 0.72
177 0.74
178 0.73
179 0.72
180 0.72
181 0.7
182 0.75
183 0.76
184 0.75
185 0.77
186 0.76
187 0.77
188 0.74
189 0.75
190 0.69
191 0.63
192 0.65
193 0.65
194 0.68
195 0.63
196 0.6
197 0.51
198 0.52
199 0.5
200 0.4
201 0.34
202 0.25
203 0.21
204 0.2
205 0.2
206 0.17
207 0.16
208 0.16
209 0.16
210 0.17
211 0.16
212 0.16
213 0.15
214 0.13
215 0.16
216 0.15
217 0.17
218 0.16
219 0.17
220 0.18
221 0.23
222 0.24
223 0.25
224 0.27