Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BXR9

Protein Details
Accession A0A1Y2BXR9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
32-55IYYVLVKREKEKRKKKNFYSIFFFHydrophilic
NLS Segment(s)
PositionSequence
38-47KREKEKRKKK
Subcellular Location(s) plas 12, E.R. 7, mito 3, pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVEVLFINCFFNFRRLMIDLLLFFLFLFLFIIYYVLVKREKEKRKKKNFYSIFFFFLIISKYIYIFINIYFFIDQEKFIFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.21
4 0.21
5 0.21
6 0.17
7 0.18
8 0.17
9 0.13
10 0.1
11 0.09
12 0.07
13 0.06
14 0.06
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.05
21 0.05
22 0.07
23 0.08
24 0.09
25 0.14
26 0.24
27 0.34
28 0.44
29 0.55
30 0.64
31 0.74
32 0.84
33 0.86
34 0.88
35 0.86
36 0.82
37 0.79
38 0.71
39 0.63
40 0.53
41 0.45
42 0.34
43 0.27
44 0.23
45 0.15
46 0.13
47 0.1
48 0.1
49 0.11
50 0.11
51 0.11
52 0.1
53 0.1
54 0.11
55 0.11
56 0.12
57 0.11
58 0.11
59 0.14
60 0.14
61 0.14