Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0EP97

Protein Details
Accession H0EP97    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
169-195EEDPEPPPKTRKNRRERKLDEKKTASIBasic
NLS Segment(s)
PositionSequence
175-188PPKTRKNRRERKLD
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MPLKRHAAIKREWWALTLEKLYPPLPEHEWDRLRDLTTGKIRLEPVPRRRRPVNRGSFGPEGDNMVVKHLLNPAKANGNLKFDESRGLLVDTKGEPESWTPGLNYQRSMRRLYGSIWQLSAKMHRDPTSKEWVVEWGDRMTITNYKEFSLPTLEEERVMKEIGWEGPPEEDPEPPPKTRKNRRERKLDEKKTASIDEQLPPNEKKAIVEEPLPSNENTASIDEQLPVVSEAEPRSHPRIPQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.42
3 0.4
4 0.34
5 0.28
6 0.25
7 0.27
8 0.26
9 0.25
10 0.25
11 0.25
12 0.25
13 0.27
14 0.29
15 0.36
16 0.4
17 0.39
18 0.42
19 0.4
20 0.38
21 0.37
22 0.34
23 0.33
24 0.36
25 0.38
26 0.34
27 0.35
28 0.36
29 0.38
30 0.46
31 0.48
32 0.51
33 0.58
34 0.63
35 0.67
36 0.75
37 0.79
38 0.78
39 0.8
40 0.8
41 0.75
42 0.73
43 0.72
44 0.66
45 0.56
46 0.49
47 0.39
48 0.3
49 0.25
50 0.23
51 0.16
52 0.15
53 0.15
54 0.13
55 0.14
56 0.17
57 0.2
58 0.18
59 0.2
60 0.2
61 0.24
62 0.26
63 0.28
64 0.26
65 0.27
66 0.27
67 0.28
68 0.27
69 0.22
70 0.23
71 0.19
72 0.17
73 0.14
74 0.15
75 0.13
76 0.12
77 0.14
78 0.11
79 0.13
80 0.12
81 0.11
82 0.1
83 0.1
84 0.14
85 0.12
86 0.13
87 0.11
88 0.15
89 0.2
90 0.21
91 0.22
92 0.23
93 0.28
94 0.3
95 0.33
96 0.3
97 0.27
98 0.27
99 0.26
100 0.28
101 0.25
102 0.23
103 0.21
104 0.2
105 0.19
106 0.18
107 0.2
108 0.16
109 0.15
110 0.17
111 0.2
112 0.22
113 0.25
114 0.29
115 0.34
116 0.33
117 0.3
118 0.28
119 0.28
120 0.28
121 0.25
122 0.22
123 0.13
124 0.13
125 0.12
126 0.13
127 0.12
128 0.13
129 0.13
130 0.15
131 0.15
132 0.16
133 0.17
134 0.16
135 0.16
136 0.15
137 0.14
138 0.14
139 0.17
140 0.16
141 0.17
142 0.17
143 0.17
144 0.15
145 0.15
146 0.12
147 0.1
148 0.12
149 0.12
150 0.13
151 0.11
152 0.11
153 0.12
154 0.13
155 0.15
156 0.13
157 0.13
158 0.14
159 0.21
160 0.24
161 0.25
162 0.31
163 0.37
164 0.47
165 0.57
166 0.65
167 0.69
168 0.77
169 0.83
170 0.88
171 0.88
172 0.89
173 0.9
174 0.89
175 0.88
176 0.82
177 0.77
178 0.71
179 0.65
180 0.55
181 0.49
182 0.42
183 0.37
184 0.36
185 0.35
186 0.36
187 0.34
188 0.35
189 0.32
190 0.29
191 0.26
192 0.26
193 0.28
194 0.25
195 0.27
196 0.28
197 0.29
198 0.33
199 0.33
200 0.28
201 0.26
202 0.23
203 0.22
204 0.19
205 0.18
206 0.16
207 0.17
208 0.17
209 0.16
210 0.16
211 0.15
212 0.14
213 0.12
214 0.11
215 0.1
216 0.12
217 0.13
218 0.17
219 0.2
220 0.25
221 0.3
222 0.33